close

SimulationCraft 406-19

for World of Warcraft 4.1.0 PTR (build level 13850)

Table of Contents

Raid Summary

DPS Chart DPS Chart Gear Chart Gear Chart Timeline Distribution Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Death_Knight_Unholy_1h_T11_372 : 23049dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
23048.7 12.71 / 0.06% 3427.5 6.7 6.8 runic_power 19.44% 50.5
Origin http://chardev.org/?profile=34574
Talents http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
Glyphs
  • horn_of_winter
  • raise_dead
  • death_and_decay
  • death_coil

Charts

http://9.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:41266|14420|9988|9486|6400|6390|6019|5963|2360|2106|1311|831&chds=0,82532&chco=9482C9,9482C9,336600,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++41266++death_and_decay,9482C9,0,0,15|t++14420++death_coil,9482C9,1,0,15|t++9988++gargoyle_strike,336600,2,0,15|t++9486++festering_strike,C79C6E,3,0,15|t++6400++scourge_strike,C79C6E,4,0,15|t++6390++sweeping_claws,C79C6E,5,0,15|t++6019++plague_strike,C79C6E,6,0,15|t++5963++icy_touch,2459FF,7,0,15|t++2360++melee,C79C6E,8,0,15|t++2106++melee_main_hand,C79C6E,9,0,15|t++1311++melee_off_hand,C79C6E,10,0,15|t++831++melee,C79C6E,11,0,15&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:16,10,10,9,9,8,6,6,6,5,5,4,4,2,0,0,0,0&chds=0,100&chco=9482C9,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,9482C9,C79C6E,336600,C79C6E,2459FF,C79C6E,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|melee|sweeping_claws|scourge_strike|melee_main_hand|scourge_strike_shadow|blood_plague|death_and_decay|melee_off_hand|gargoyle_strike|claw|frost_fever|festering_strike|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:RdrMFQdnvxxz5743554443357876664320zxwwwwwwusqonmllkjiihgfeedcccbaZZZZZYYYXXXXXWWWWVVVVVVVUUUVVVVVVUUUUUUVVVVUUUVVVVVVVVVVWWVVVWWWWWWWVVVVVVVVVVVVVVVUUUUUUUUVVUUUVVVUVVVVVVVVVWVVWWWWWXXWVVVVVVVVVVVVWWWWWWWWWXXXXXXWWVVVVVUUUUUVVVVUUVVVVVVVVVVVVWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVVUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVXZbcdddccccccbbaaaaZZYYYYYYXXYYYZaaaaabbcdeffgggggffeedcbbbbaaaaaZZZYYYYYYYYYYYYXXXYYYYXXXWWWVVVVVVVVVVVUUUVVVVVVVVVVVVVUUVVVVVVVVVVVVVVVVVVVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=76&chtt=Death_Knight_Unholy_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uvxyz001222456877765421zywvusrppnmlkjihggfffeedcccbbaaZZZYYYYYYYYYZZZZZZZaZaZZZZZZZYYYYXXXXXXXXXXXXXXXYYYYZZZZZaaaaaabbbbbbbcbcccccccccccccbbbbaaZZZYYXXWXWWWWWWWWWWWXXXXXXYYYYZZZZaaaabbbcccdddeefffgggggggggggfffeeeeddddccccccccccccccccccccbbbbbaaaaZZZZZZZYYYYYYYYYYYYYYYYYYXYXXXXXXXXXXXXYXXYYYYYYYYYYYZZZZZZZZZZZZZZZZaaaaaabbbccccccddddddcdcccccccccccbcccccccccccdddddeeeefffffgggggggggggggggfffeeeddcccbbaaaaZZZZZZZZZZZZZZaaaaaaabbbbbbbbbbbbbbbbaabaab&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=23049|max=47922&chxp=1,1,48,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,1,3,7,5,22,15,27,39,57,87,97,153,207,258,266,305,367,408,440,497,535,555,538,598,506,525,482,467,392,345,293,275,237,235,172,140,112,90,59,52,36,31,22,11,15,7,4,2&chds=0,598&chbh=5&chxt=x&chxl=0:|min=20851|avg=23049|max=25249&chxp=0,1,50,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_1h_T11_372 23049
blood_plague 1414 6.1% 7.2 67.37sec 89242 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3635 7598 15.7% 0.0% 99.6%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.16 7.16 150.21 150.21 0.0000 3.0000 639277
Direct Results Count Pct Average Min Max Total Damage
hit 7.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.7 84.34% 3635.38 2900 5300 460568
crit 23.5 15.66% 7598.17 6061 11077 178708

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 3.1 78.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.07 3.07 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.0 50.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.96 8.96 0.00 0.00 1.0162 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.0 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1347 5.8% 14.5 32.23sec 41966 41266 0 0 0 15.8% 0.0% 0.0% 0.0% 243 2146 4483 15.6% 0.0% 50.4%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.51 14.51 242.51 242.51 1.0170 0.9402 608995
Direct Results Count Pct Average Min Max Total Damage
hit 12.2 84.22% 0.00 0 0 0
crit 2.3 15.78% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 204.6 84.36% 2145.70 1748 3185 438983
crit 37.9 15.64% 4483.46 3653 6657 170012

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:16
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3659 15.9% 113.9 3.92sec 14526 14420 11854 24779 34578 20.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.90 113.90 0.00 0.00 1.0074 0.0000 1654535
Direct Results Count Pct Average Min Max Total Damage
hit 90.3 79.32% 11853.94 9830 16544 1070988
crit 23.6 20.68% 24778.94 20546 34578 583547

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 Runic Power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 302.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 917 4.0% 43.1 10.53sec 9621 9486 8649 17800 23285 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.10 43.10 0.00 0.00 1.0142 0.0000 414627
Direct Results Count Pct Average Min Max Total Damage
hit 38.5 89.38% 8648.65 7462 11303 333145
crit 4.6 10.62% 17800.16 15372 23285 81482

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 1004 4.4% 8.7 54.10sec 52133 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5390 15.7% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.71 8.71 150.28 150.28 0.0000 3.0000 453826
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.7 84.34% 2579.72 2055 3767 326969
crit 23.5 15.66% 5390.48 4295 7874 126857

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 37 0.2% 2.8 109.37sec 6053 5963 5146 10765 15729 16.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0150 0.0000 16707
Direct Results Count Pct Average Min Max Total Damage
hit 2.3 83.85% 5145.55 4323 7526 11909
crit 0.4 16.15% 10765.00 9269 15729 4798

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2103 9.1% 263.2 1.72sec 3614 2106 4046 8336 11234 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
263.17 263.17 0.00 0.00 1.7158 0.0000 951115
Direct Results Count Pct Average Min Max Total Damage
hit 130.1 49.44% 4045.70 3414 5454 526399
crit 27.9 10.62% 8335.97 7033 11234 232959
glance 63.2 24.01% 3034.16 2560 4090 191757
miss 41.9 15.93% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1309 5.7% 262.4 1.72sec 2256 1311 2527 5205 7021 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.38 262.38 0.00 0.00 1.7209 0.0000 591879
Direct Results Count Pct Average Min Max Total Damage
hit 129.8 49.46% 2526.88 2134 3408 327956
crit 27.7 10.57% 5205.07 4395 7021 144371
glance 63.1 24.04% 1895.56 1600 2556 119552
miss 41.8 15.93% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.9 82.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 0.00 0.00 1.0161 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 17 0.1% 1.2 134.22sec 6139 6019 5500 11267 14741 11.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.22 1.22 0.00 0.00 1.0200 0.0000 7480
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 88.91% 5499.83 4890 7391 5958
crit 0.1 11.09% 11267.16 10136 14741 1522

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 2152 9.3% 150.1 2.99sec 6487 6400 5832 12013 15662 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.05 150.05 0.00 0.00 1.0136 0.0000 973381
Direct Results Count Pct Average Min Max Total Damage
hit 134.1 89.40% 5831.96 5042 7603 782343
crit 15.9 10.60% 12012.61 10387 15662 191038

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 1760 7.6% 150.1 2.99sec 5304 0 5304 0 12806 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.05 150.05 0.00 0.00 0.0000 0.0000 795860
Direct Results Count Pct Average Min Max Total Damage
hit 150.1 100.00% 5303.94 3028 12806 795860

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:6527.66
  • base_dd_max:6527.66
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.3 218.47sec 0 0 0 0 0 15.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.29 2.29 0.00 0.00 1.0054 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 1.9 84.42% 0.00 0 0 0
crit 0.4 15.58% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 359 1.6% 113.9 3.92sec 1426 0 0 0 0 0.0% 0.0% 0.0% 0.0% 407 399 0 0.0% 0.0% 90.0%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.90 113.90 407.08 407.08 0.0000 1.0000 162442
Direct Results Count Pct Average Min Max Total Damage
hit 113.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 407.1 100.00% 399.04 101 1357 162442

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:519.98
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1412
claw 605 42.8% 13.0 2.86sec 1628 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21167
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.83% 1491.43 1491 1491 17610
crit 1.2 9.17% 2982.86 2983 2983 3556

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 807 57.2% 23.0 1.48sec 1228 831 1189 2379 2379 9.3% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 1.4776 0.0000 28252
Direct Results Count Pct Average Min Max Total Damage
hit 15.3 66.73% 1189.27 1189 1189 18253
crit 2.1 9.28% 2378.55 2379 2379 5078
glance 5.5 23.99% 891.95 892 892 4921

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1753
gargoyle_strike 1753 100.0% 48.4 6.44sec 11251 9988 11251 0 16064 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.39 48.39 0.00 0.00 1.1265 0.0000 544461
Direct Results Count Pct Average Min Max Total Damage
hit 48.4 100.00% 11251.26 8668 16064 544461

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 5659
claw 1061 18.8% 117.4 3.80sec 4087 0 3744 7482 11262 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.43 117.43 0.00 0.00 0.0000 0.0000 480005
Direct Results Count Pct Average Min Max Total Damage
hit 106.6 90.81% 3743.87 2746 5631 399260
crit 10.8 9.19% 7482.39 5492 11262 80745

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2358 41.7% 341.0 1.33sec 3127 2360 3030 6061 9221 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
340.98 340.98 0.00 0.00 1.3249 0.0000 1066223
Direct Results Count Pct Average Min Max Total Damage
hit 227.7 66.77% 3029.95 1861 4611 689859
crit 31.4 9.21% 6061.18 3722 9221 190347
glance 81.9 24.02% 2271.45 1396 3458 186017

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2240 39.6% 152.9 2.79sec 6627 6390 6070 12139 16633 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
152.89 152.89 0.00 0.00 1.0370 0.0000 1013164
Direct Results Count Pct Average Min Max Total Damage
hit 138.9 90.83% 6070.08 5273 8316 842979
crit 14.0 9.17% 12138.74 10545 16633 170185

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_1h_T11_372
death_coil runic_power 95.5% 569.8 25
summon_gargoyle runic_power 4.5% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 43.4% 102.2 40
sweeping_claws energy 56.6% 165.7 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.3 180.3 0.1 0.3%
horn_of_winter runic_power 17.9 179.1 10.0 0.0%
rune_abilities runic_power 223.6 2709.9 12.1 0.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 430.7 3.1 0.0%
pet - ghoul energy
energy_regen energy 1809.3 10734.5 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.3 0.0 57.6sec 57.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.0 0.0 50.9sec 50.9sec 57% 57%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 107.1sec 107.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.3 46.0 49.3sec 8.1sec 84% 83%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 43.8 0.0 10.1sec 10.1sec 34% 34%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.3 38.4 50.4sec 9.3sec 36% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 28.5 0.2 15.5sec 15.4sec 4% 4%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 79.4 281.9sec 5.5sec 98% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.1 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.3 48.4 220.2sec 6.2sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.65%
σ of the average dps 6.3536
2 * σ / μ 0.0551%
95% Confidence Intervall ( μ ± 2σ ) ( 23036.00 - 23061.41 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 23029.65 - 23067.77 )
Sample Data
σ 635.3608
Minimum 20851.43
Maximum 25249.46
Spread ( max - min ) 4398.02
Range ( max - min ) / 2 2199.01
Range% 9.54
10th Percentile 22264.24
90th Percentile 23925.23
( 90th Percentile - 10th Percentile ) 1661.00
Approx. Iterations needed for
1% dps error 30
0.1% dps error 3039
0.1 scale factor error with delta=300 3588
0.05 scale factor error with delta=300 14353
0.01 scale factor error with delta=300 358829
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQNPPP5RPPPPQMPRQRTDJJPPMPNPLMOPRPPPRRQPRRPPNQRPNPRPPPRNQPRUQORDPRPPSPPRPQRPUQRPPRPPPRAOPURQPRQRPNPRDPPRSPPPRUQRP5RQORPRPPRPPNPRUQPRQRPPPPRPSPPOBANRUDQRRPQ9RPPPPNPPGURPQOQRRPPPRPRPPRPQRPQRUDPPRPSPPPROQRUPRQPPPRAPPP5RRPUQROQRRDPPRPPPRUPQNRPQRPPPRONPPRUPNQRRPQRPPPNDPPNARPQRTILPMPPPMPPRPRURQRPQRPPRPPPRSPOPNRQPUR9QDRPPP5RPPGPQURPQORPPRPPSPPRPAURQPRQRPNDPORPRPPURQNPRQPRPRPPURNPOPRQPRQPRPPUPRBADRPQPRQORUPPRP7PSPP5RPQRPUQRPPROPPRPPUBRCQRDQNPPPRPPN9RORUPQ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7000 5632 4914
Agility 721 138 20
Stamina 7637 6015 5825
Intellect 55 53 20
Spirit 85 85 20
Health 149873 127235 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.48% 18.48% 971
Spell Crit 12.45% 7.45% 1336
Spell Haste 12.35% 7.00% 896
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16794 12394 190
Melee Hit 11.08% 11.08% 971
Melee Crit 15.41% 8.02% 1336
Melee Haste 23.05% 7.00% 896
Expertise 27.04 27.04 812
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.08% 16.08% 1448

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 2
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 1
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 0
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_1h_T11_372
origin="http://chardev.org/?profile=34574"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
glyphs=horn_of_winter/raise_dead/death_and_decay/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
# Gear Summary # gear_strength=4914
# gear_agility=20
# gear_stamina=5825
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=812
# gear_hit_rating=971
# gear_crit_rating=1336
# gear_haste_rating=896
# gear_mastery_rating=1448
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_2h_T11_372 : 26531dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26531.4 13.57 / 0.05% 3679.3 7.2 7.3 runic_power 11.13% 55.5
Origin http://chardev.org/?profile=87453
Talents http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
Glyphs
  • blood_boil
  • pestilence
  • antimagic_shell
  • horn_of_winter
  • blood_tap
  • raise_ally
  • scourge_strike
  • raise_dead
  • death_coil

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:27717|13580|13346|10414|8983|8587|6436|5810|2798|2610|914&chds=0,55434&chco=9482C9,9482C9,C79C6E,336600,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E&chm=t++27717++death_and_decay,9482C9,0,0,15|t++13580++death_coil,9482C9,1,0,15|t++13346++festering_strike,C79C6E,2,0,15|t++10414++gargoyle_strike,336600,3,0,15|t++8983++scourge_strike,C79C6E,4,0,15|t++8587++plague_strike,C79C6E,5,0,15|t++6436++sweeping_claws,C79C6E,6,0,15|t++5810++icy_touch,2459FF,7,0,15|t++2798++melee_main_hand,C79C6E,8,0,15|t++2610++melee,C79C6E,9,0,15|t++914++melee,C79C6E,10,0,15&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:14,13,13,11,10,9,6,5,5,4,4,3,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,9482C9,C79C6E,2459FF,9482C9,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|scourge_strike_shadow|scourge_strike|melee_main_hand|melee|sweeping_claws|gargoyle_strike|festering_strike|blood_plague|claw|frost_fever|death_and_decay|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:QcpMENWemmqv24224334644578766765432110000zyxwuttssrrrrrqqppponmmmlkkjjiihhhgfffeeddccccbbbaaaaaZZZZZZYYYYYYYYYYYYYXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXYXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYZZXWWWWWWXXYYYZaaabbccddeeeffffeedcbbaaZZZYYYYYYYXYXXXXYXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXXXXXXXXXXXXXXXXXXXXYXXXYXXXYYYYYYYYYZYZZYZZZZZZYYYYZZZZZZZaaabcdefgghijklllmmmlllkjjiihhhhhghggghhhhhhhhhiiiihhgfeeddccbbbbaaaZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=80&chtt=Death_Knight_Unholy_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:vwxyzz001113567777765320zyxwvtsrqpnnlkjiihhhhggffeeddcccbcbbbbbccccccccccdddddddddccbbbbaaaaaaaaZZZZZZZZZZZaaaaabbbbbccccdddeeefffffffffffeeeeddcccbbaaaZZZZZZZZZZZZZZaZaaaaababbbcbccdddeeffgghhhiijjjkkkkkkjkjjjiihhhhggggffffffffffeeeeeeeeddddccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbabaaaaaaaaaaaaaaaaaaaaaaaaaZaZZZZZZaaaaaaabbbbbcccccdddddddddddddddccddddddddeeeefffggghhhiijjjkkllmmnnnoooooonnnnmmllkkjiihgffeedddccccccccbcbbbcccccccccccccbbbbbbbbbbbbbbbbbbc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26531|max=50805&chxp=1,1,52,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,3,6,8,19,21,26,47,52,72,106,153,202,220,311,329,377,435,458,527,572,586,561,594,590,527,518,473,413,362,299,221,221,182,133,114,77,63,41,26,28,13,4,1,2,1,1,0,1&chds=0,594&chbh=5&chxt=x&chxl=0:|min=24161|avg=26531|max=29201&chxp=0,1,47,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_2h_T11_372 26531
blood_plague 1332 5.0% 6.3 77.39sec 95821 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3518 7356 12.8% 0.0% 99.7%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.29 6.29 150.31 150.31 0.0000 3.0000 602475
Direct Results Count Pct Average Min Max Total Damage
hit 6.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.23% 3518.04 2817 5142 461278
crit 19.2 12.77% 7356.13 5888 10746 141197

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 2.1 110.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.11 2.11 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.4 48.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.44 9.44 0.00 0.00 1.0121 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.4 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 911 3.4% 14.7 31.86sec 28072 27717 0 0 0 12.9% 0.0% 0.0% 0.0% 174 2079 4346 12.7% 0.0% 35.2%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.67 14.67 173.99 173.99 1.0128 0.9157 411884
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 87.09% 0.00 0 0 0
crit 1.9 12.91% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.9 87.30% 2079.32 1698 3090 315830
crit 22.1 12.70% 4346.32 3549 6458 96054

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:11
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3844 14.5% 127.1 3.52sec 13671 13580 11460 23948 33535 17.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.14 127.14 0.00 0.00 1.0067 0.0000 1738150
Direct Results Count Pct Average Min Max Total Damage
hit 104.6 82.30% 11460.26 9543 16045 1199159
crit 22.5 17.70% 23948.45 19946 33535 538991

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 Runic Power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.97 1.97 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 1450 5.5% 48.6 9.33sec 13500 13346 12790 26369 33998 7.5% 2.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.58 48.58 0.00 0.00 1.0115 0.0000 655819
Direct Results Count Pct Average Min Max Total Damage
hit 43.7 90.04% 12790.24 11218 16504 559459
crit 3.7 7.52% 26369.49 23109 33998 96359
dodge 1.2 2.44% 0.00 0 0 0

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 977 3.7% 8.4 55.51sec 52647 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2581 5392 12.8% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.39 8.39 150.32 150.32 0.0000 3.0000 441879
Direct Results Count Pct Average Min Max Total Damage
hit 8.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.23% 2580.51 2064 3777 338355
crit 19.2 12.77% 5392.20 4313 7894 103524

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 35 0.1% 2.7 114.93sec 5875 5810 5168 10807 15768 12.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.72 2.72 0.00 0.00 1.0113 0.0000 15966
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.46% 5167.80 4338 7545 12283
crit 0.3 12.54% 10807.46 9302 15768 3683

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2792 10.5% 196.9 2.30sec 6411 2798 6430 13239 17541 7.7% 2.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
196.92 196.92 0.00 0.00 2.2914 0.0000 1262506
Direct Results Count Pct Average Min Max Total Damage
hit 129.6 65.82% 6430.38 5531 8515 833435
crit 15.2 7.73% 13238.73 11394 17541 201413
glance 47.2 23.96% 4824.14 4148 6386 227658
dodge 4.9 2.49% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.7 87.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.68 5.68 0.00 0.00 1.0138 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 12 0.0% 0.6 146.32sec 8732 8587 8243 17021 21701 7.7% 2.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.63 0.63 0.00 0.00 1.0169 0.0000 5466
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 90.06% 8243.42 7458 10858 4647
crit 0.0 7.68% 17021.04 15279 21701 819
dodge 0.0 2.25% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 3455 13.0% 172.1 2.60sec 9077 8983 8599 17713 22804 7.6% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
172.13 172.13 0.00 0.00 1.0104 0.0000 1562351
Direct Results Count Pct Average Min Max Total Damage
hit 154.9 90.00% 8599.37 7546 11070 1332137
crit 13.0 7.55% 17713.18 15545 22804 230215
dodge 4.2 2.45% 0.00 0 0 0

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 3554 13.4% 167.9 2.67sec 9569 0 9569 0 23453 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.91 167.91 0.00 0.00 0.0000 0.0000 1606788
Direct Results Count Pct Average Min Max Total Damage
hit 167.9 100.00% 9569.46 7760 23453 1606788

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:9573.78
  • base_dd_max:9573.78
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.7 196.86sec 0 0 0 0 0 12.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0055 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.06% 0.00 0 0 0
crit 0.4 12.94% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 377 1.4% 127.1 3.52sec 1341 0 0 0 0 0.0% 0.0% 0.0% 0.0% 411 415 0 0.0% 0.0% 90.8%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.14 127.14 410.63 410.63 0.0000 1.0000 170499
Direct Results Count Pct Average Min Max Total Damage
hit 127.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 410.6 100.00% 415.22 98 1295 170499

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:294.73
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1563
claw 652 41.7% 14.0 2.62sec 1629 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 0.0000 0.0000 22811
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 90.75% 1491.43 1491 1491 18949
crit 1.3 9.25% 2982.86 2983 2983 3862

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 912 58.3% 26.0 1.34sec 1227 914 1189 2379 2379 9.1% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.00 26.00 0.00 0.00 1.3426 0.0000 31903
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 66.98% 1189.27 1189 1189 20711
crit 2.4 9.15% 2378.55 2379 2379 5656
glance 6.2 23.88% 891.95 892 892 5537

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1870
gargoyle_strike 1870 100.0% 62.5 5.93sec 11021 10414 11021 0 16107 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.47 62.47 0.00 0.00 1.0584 0.0000 688542
Direct Results Count Pct Average Min Max Total Damage
hit 62.5 100.00% 11021.45 8704 16107 688542

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 6145
claw 1037 16.9% 115.5 3.86sec 4062 0 3719 7434 11289 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.46 115.46 0.00 0.00 0.0000 0.0000 468993
Direct Results Count Pct Average Min Max Total Damage
hit 104.8 90.76% 3718.61 2755 5645 389677
crit 10.7 9.24% 7434.00 5511 11289 79316

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2607 42.4% 373.3 1.21sec 3159 2610 3061 6125 9243 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
373.26 373.26 0.00 0.00 1.2105 0.0000 1179189
Direct Results Count Pct Average Min Max Total Damage
hit 249.3 66.78% 3061.14 1867 4622 763025
crit 34.4 9.20% 6124.81 3734 9243 210417
glance 89.6 24.02% 2295.29 1400 3466 205747

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2501 40.7% 169.5 2.53sec 6674 6436 6110 12222 16673 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
169.46 169.46 0.00 0.00 1.0369 0.0000 1130897
Direct Results Count Pct Average Min Max Total Damage
hit 153.8 90.78% 6109.89 5291 8337 939861
crit 15.6 9.22% 12221.64 10581 16673 191036

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_2h_T11_372
death_coil runic_power 94.9% 561.5 24
summon_gargoyle runic_power 5.1% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 40.5% 101.5 40
sweeping_claws energy 59.5% 166.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.3 179.7 0.1 0.7%
horn_of_winter runic_power 15.0 150.2 10.0 0.0%
rune_abilities runic_power 245.7 2965.9 12.1 0.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 474.0 3.4 0.0%
pet - ghoul energy
energy_regen energy 1809.3 11317.9 6.3 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.7 0.0 61.2sec 61.2sec 25% 25%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.4 0.0 48.2sec 48.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.5 0.0 111.1sec 111.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.7 42.0 47.6sec 8.6sec 82% 82%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 47.9 0.0 9.3sec 9.3sec 38% 38%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.8 40.4 48.1sec 8.8sec 34% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 36.2 0.3 12.3sec 12.2sec 6% 6%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 88.7 261.3sec 5.0sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.7 62.5 196.1sec 5.7sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.77%
σ of the average dps 6.7842
2 * σ / μ 0.0511%
95% Confidence Intervall ( μ ± 2σ ) ( 26517.83 - 26544.97 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26511.05 - 26551.75 )
Sample Data
σ 678.4212
Minimum 24161.36
Maximum 29201.11
Spread ( max - min ) 5039.75
Range ( max - min ) / 2 2519.87
Range% 9.50
10th Percentile 25694.60
90th Percentile 27443.09
( 90th Percentile - 10th Percentile ) 1748.49
Approx. Iterations needed for
1% dps error 26
0.1% dps error 2615
0.1 scale factor error with delta=300 4091
0.05 scale factor error with delta=300 16364
0.01 scale factor error with delta=300 409115
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQNPJJ5NPLMKMJJJMDLMNPPJMPLPMOPPMPNPPMNPQMMPQMPPPPMMPPPMMPLMDMLOMPPPMPPRRQNPRQPRTJJJPPPMPRQRPRQUROPPPRBAPPRQRDRUQNRPPPR5OPPRPQPRQUPRNPPNPPPRRPQRPUQROPPRDPNSPPNPRA9QRPUQPGPPPRPPRORQPRQRUPPRPPPPRPRQDRRQUPROPPRPSPPRPQRNPQRPPUPRP5PPRPBAORNQUPQPRPPPNDPMMRPQRPQRPPPRUROSPPPRPQRPQRPPPRPUPPRPQRPNQRDOPRNPPPRURAPNQPQRRPPNPRPPPRUPQ9ROQRNPJJPP5GPPQRPUQPRDNPPPPNPMRTILPMQRPPPRRPPPRPQRNPQRPPPRPPPROQRUPQQNRRDPPPPPRPQRURPQRRPOPRAPPPPQRRUPQRRPPPRDPPRPQRO7QRU5RPPPRPPPRPQQRRPQUPPNPRROPPRPQRDBAURRPPPR9PQPQR

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7032 5662 4942
Agility 721 138 20
Stamina 7677 6053 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150433 127767 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.59% 18.59% 982
Spell Crit 9.56% 4.56% 818
Spell Haste 23.65% 17.76% 2274
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16866 12455 190
Melee Hit 8.18% 8.18% 982
Melee Crit 12.52% 5.13% 818
Melee Haste 35.42% 17.76% 2274
Expertise 16.12 16.12 484
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.26% 14.26% 1123

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 1
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 0
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 1
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 3
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 1
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_2h_T11_372
origin="http://chardev.org/?profile=87453"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
glyphs=blood_boil/pestilence/antimagic_shell/horn_of_winter/blood_tap/raise_ally/scourge_strike/raise_dead/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs=sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
# Gear Summary # gear_strength=4942
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=484
# gear_hit_rating=982
# gear_crit_rating=818
# gear_haste_rating=2274
# gear_mastery_rating=1123
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_1h_T11_372_PTR : 29007dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
29007.0 12.18 / 0.04% 3031.4 9.6 9.7 runic_power 0.48% 47.7
Origin http://chardev.org/?profile=75143
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:17742|16592|11916|3626|2704|1808|1688|757&chds=0,35483&chco=2459FF,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++17742++howling_blast,2459FF,0,0,15|t++16592++obliterate,C79C6E,1,0,15|t++11916++frost_strike,2459FF,2,0,15|t++3626++plague_strike,C79C6E,3,0,15|t++2704++melee_main_hand,C79C6E,4,0,15|t++1808++melee,C79C6E,5,0,15|t++1688++melee_off_hand,C79C6E,6,0,15|t++757++melee,C79C6E,7,0,15&chtt=Death_Knight_Frost_1h_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:19,17,12,12,11,9,6,4,3,3,2,1,0,0,0,0&chds=0,100&chco=C79C6E,2459FF,2459FF,C79C6E,2459FF,C79C6E,C79C6E,2459FF,9482C9,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|howling_blast|obliterate_offhand|frost_strike_offhand|melee_main_hand|melee_off_hand|frost_fever|blood_plague|claw|melee|razorice|plague_strike|melee|plague_strike_offhand|claw&chtt=Death_Knight_Frost_1h_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:UVgx71nrtwwtw011yww0zxutwyxvtrv00vrqswxvrppsutrplkknqqpomlloomkkkmpqssssrrrstuttssrrstttsrrrrsttttttsssssrrqqrrssssssssttsqoooopqqqqssstuuuutttttuuutttsttuutttttttuvvvuuuuvuuuuuuuvvutrqqqrrrrrrrssttvvvvvvwwwvvvvvvvvvvvvuvvvvvvvvvwxxxxwwwwwwvvutsrqqpppppppqqqqqqqqqssstttuuuuvvvvvvvvvvvvvvvvvwvvvwwwwwwwvutsqqpooooooppppppppqqqqqrrssttuuvvwwwwwwxxxxxxxxxyxxxxyyyyyyyyyyxxwwwwvwwwwxwwwxxxxxxxxxxxxyyyyyzzzzzzzzzzzzzzzzyyyyyyyxxxwwvuutttttttttttttttttutuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Death_Knight_Frost_1h_T11_372_PTR+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z022344556587777766543200yxwvutssrrqqppppoooooonnnnnnmlllllllllllkkkkjjjiihihhgggfffeeeddcccccccccccdddeeeffgghhiiijjjjkjjjjjjiiiiiiihhhhgggfggffffeeeeedddcccccccccccccccccccddddeeeeeffffffggggghhhhhhhiiiiiijjjkkkkllllmllllllllkkkkkjjjjiiiiiiiiiiiiiiiihhhhhhggggfffffeeeeeeeeeeeeeeeeffeeeeeeeeeeeeeeeeeffffghhiijjkkllmlmmmmmllllllkkkjjjiiiiiiiiiiihhhhhhhgggggggggghhhiiijjkklmmnnnnooonnnnnmmmlllkkkkkjjjjjkkkkkllllmmmmmnnnnnnnnoooooooooooonnnnnnnnnnmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=29007|max=48640&chxp=1,1,60,100&chtt=Death_Knight_Frost_1h_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:5,3,2,5,5,8,27,50,46,67,103,124,193,251,270,354,387,479,568,602,623,595,675,593,614,554,511,462,363,370,269,232,160,119,83,72,42,54,22,14,12,5,3,2,0,1,0,0,0,1&chds=0,675&chbh=5&chxt=x&chxl=0:|min=26838|avg=29007|max=31745&chxp=0,1,44,100&chtt=Death_Knight_Frost_1h_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T11_372_PTR 29007
blood_plague 912 3.1% 21.0 33.39sec 19646 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2325 4860 17.0% 0.0% 99.3%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.99 20.99 149.60 149.60 0.0000 3.0000 412297
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.2 82.99% 2324.69 1633 3924 288639
crit 25.4 17.01% 4860.34 3414 8202 123659

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 6.1 76.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.10 6.10 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.8 330.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.81 1.81 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.8 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1277 4.4% 79.6 5.71sec 7250 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3241 6772 17.0% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.64 79.64 150.32 150.32 0.0000 3.0000 577444
Direct Results Count Pct Average Min Max Total Damage
hit 79.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.7 82.99% 3240.78 2248 5418 404286
crit 25.6 17.01% 6772.32 4698 11323 173158

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 5012 17.3% 133.5 3.36sec 16980 11916 12756 26293 42117 31.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
133.46 133.46 0.00 0.00 1.4250 0.0000 2266136
Direct Results Count Pct Average Min Max Total Damage
hit 91.8 68.79% 12755.83 9197 20445 1171082
crit 41.6 31.21% 26292.83 18946 42117 1095054

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage plus $s1 as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
frost_strike_offhand 3143 10.8% 133.5 3.36sec 10647 0 8000 16484 25576 31.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
133.46 133.46 0.00 0.00 0.0000 0.0000 1420876
Direct Results Count Pct Average Min Max Total Damage
hit 91.8 68.80% 7999.65 5751 12782 734491
crit 41.6 31.20% 16483.55 11846 25576 686385

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:runic_power
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:139.53
  • base_dd_max:139.53
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
howling_blast 3480 12.0% 73.9 6.09sec 21287 17742 18660 39010 64660 14.6% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
73.92 73.92 0.00 0.00 1.1998 0.0000 1573594
Direct Results Count Pct Average Min Max Total Damage
hit 61.7 83.47% 18660.23 12853 31989 1151456
crit 10.8 14.64% 39009.60 26862 64660 422138
miss 1.4 1.89% 0.00 0 0 0

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.48)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.48)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1369.63
  • base_dd_max:1513.20
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2701 9.3% 294.1 1.54sec 4152 2704 4724 9727 14771 12.0% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
294.15 294.15 0.00 0.00 1.5354 0.0000 1221348
Direct Results Count Pct Average Min Max Total Damage
hit 133.1 45.26% 4723.75 3480 7170 628843
crit 35.2 11.98% 9726.89 7168 14771 342733
glance 70.5 23.96% 3544.02 2610 5378 249772
miss 55.3 18.80% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1686 5.8% 293.5 1.54sec 2598 1688 2957 6092 9157 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.52 293.52 0.00 0.00 1.5387 0.0000 762495
Direct Results Count Pct Average Min Max Total Damage
hit 132.9 45.27% 2957.26 2175 4481 392954
crit 35.0 11.92% 6091.51 4480 9157 213213
glance 70.5 24.01% 2218.02 1631 3361 156328
miss 55.2 18.79% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 5409 18.6% 103.8 4.36sec 23566 16592 17153 35578 53914 34.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.77 103.77 0.00 0.00 1.4203 0.0000 2445358
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 65.20% 17153.38 12498 26908 1160489
crit 36.1 34.80% 35577.85 25746 53914 1284869

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage plus $s1. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
obliterate_offhand 3390 11.7% 103.8 4.36sec 14769 0 10753 22307 33696 34.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.77 103.77 0.00 0.00 0.0000 0.0000 1532579
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 65.24% 10753.14 7811 16818 727981
crit 36.1 34.76% 22307.43 16091 33696 804598

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% offhand weapon damage plus a bonus. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:325.19
  • base_dd_max:325.19
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.74sec 0 0 0 0 0 0.0% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.25 7.25 0.00 0.00 1.1984 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.1 98.09% 0.00 0 0 0
miss 0.1 1.91% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 61.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.88 7.88 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.9 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 80 0.3% 6.9 65.64sec 5195 3626 4611 9489 14173 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.94 6.94 0.00 0.00 1.4325 0.0000 36026
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.04% 4611.14 3613 7079 28153
crit 0.8 11.96% 9488.60 7442 14173 7873

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 50 0.2% 6.9 65.64sec 3255 0 2888 5945 8857 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.94 6.94 0.00 0.00 0.0000 0.0000 22577
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 87.99% 2888.50 2257 4424 17627
crit 0.8 12.01% 5944.79 4650 8857 4950

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% offhand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:210.42
  • base_dd_max:210.42
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
razorice 254 0.9% 482.5 0.94sec 238 0 238 0 338 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
482.52 482.52 0.00 0.00 0.0000 0.0000 114842
Direct Results Count Pct Average Min Max Total Damage
hit 482.5 100.00% 238.00 182 338 114842

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:949.00
  • base_dd_max:1764.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
pet - army_of_the_dead_ghoul_8 1296
claw 559 43.1% 12.0 3.09sec 1630 0 1491 2983 2983 9.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 19561
Direct Results Count Pct Average Min Max Total Damage
hit 10.9 90.71% 1491.43 1491 1491 16234
crit 1.1 9.29% 2982.86 2983 2983 3327

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 737 56.9% 21.0 1.62sec 1228 757 1189 2379 2379 9.2% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 21.00 0.00 0.00 1.6225 0.0000 25786
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 66.89% 1189.27 1189 1189 16705
crit 1.9 9.22% 2378.55 2379 2379 4606
glance 5.0 23.89% 891.95 892 892 4475

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1666
claw 946 56.8% 105.8 3.83sec 3674 0 3365 6726 8749 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
105.77 105.77 0.00 0.00 0.0000 0.0000 388564
Direct Results Count Pct Average Min Max Total Damage
hit 96.0 90.80% 3364.61 2497 4374 323149
crit 9.7 9.20% 6725.73 4993 8749 65414

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 719 43.2% 124.5 3.23sec 2373 1808 2299 4600 5847 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.46 124.46 0.00 0.00 1.3129 0.0000 295361
Direct Results Count Pct Average Min Max Total Damage
hit 83.0 66.72% 2298.92 1714 2923 190904
crit 11.5 9.23% 4599.81 3429 5847 52837
glance 29.9 24.05% 1724.65 1286 2192 51620

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_1h_T11_372_PTR
frost_strike runic_power 98.7% 530.6 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.8 40
pet - ghoul
claw energy 100.0% 91.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.3 88.0 0.0 2.8%
chill_of_the_grave runic_power 176.3 1704.9 9.7 3.3%
frost_presence runic_power 113.5 200.0 1.8 1.6%
horn_of_winter runic_power 2.2 21.6 10.0 0.0%
improved_frost_presence runic_power 21.0 15.9 0.8 0.1%
rune_abilities runic_power 134.5 2371.6 17.6 2.4%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 392.2 2.8 0.0%
pet - ghoul energy
energy_regen energy 667.8 3978.7 6.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.7 0.0 54.8sec 54.8sec 28% 28%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
frost_presence 2.0 0.0 55.4sec 55.4sec 88% 85%

Database details

  • id:
  • cooldown name:buff_frost_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 395.0sec 395.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.7sec 104.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 50.0 1.8 9.0sec 8.6sec 11% 21%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.9 0.0 61.3sec 61.3sec 34% 35%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 61.0 32.5 7.4sec 4.8sec 42% 82%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_razorice 1.0 481.5 0.0sec 0.9sec 100% 100%

Database details

  • id:
  • cooldown name:buff_rune_of_razorice
  • tooltip:(null)
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rune_of_the_fallen_crusader 10.8 31.0 42.5sec 10.6sec 75% 75%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 99.6 0.0sec 4.5sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 12% 13%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 59.0 7.6sec
runic_empowerment_wasted 1.0 116.8sec

Statistics & Data Analysis

DPS
Population
Convergence 70.24%
σ of the average dps 6.0902
2 * σ / μ 0.0420%
95% Confidence Intervall ( μ ± 2σ ) ( 28994.77 - 29019.13 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28988.68 - 29025.22 )
Sample Data
σ 609.0209
Minimum 26837.60
Maximum 31744.50
Spread ( max - min ) 4906.91
Range ( max - min ) / 2 2453.45
Range% 8.46
10th Percentile 28251.57
90th Percentile 29810.43
( 90th Percentile - 10th Percentile ) 1558.86
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1763
0.1 scale factor error with delta=300 3296
0.05 scale factor error with delta=300 13187
0.01 scale factor error with delta=300 329694
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
3 presence,choose=unholy,if=buff.bloodlust.react
4 army_of_the_dead
5 snapshot_stats
6 blood_fury,time>=10
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 pillar_of_frost
A raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
B raise_dead,time>=15
C outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
D howling_blast,if=dot.frost_fever.remains<=2
E plague_strike,if=dot.blood_plague.remains<=2
F obliterate,if=frost=2&unholy=2
G obliterate,if=death=2
H obliterate,if=buff.killing_machine.react
I blood_tap,if=buff.killing_machine.react
J empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T empower_rune_weapon
U horn_of_winter

Sample Sequence

0124789C3FGGMLIQGGL6MQOOLBMQOGLMLQOMGLMQFEMLOLHLGLMQQ2OMNQOMQOQHMQ9QQGCQRHQGMQQOMQOQSOOMKQOMNKEQQRNQOMQOMOKMOKM9KOKMOK6CGKMHKKQGQOMIHKQOMOKMKHKEMHKMKOKMGGKK9QQTFGGKKMHBCGKKMOKMGKHKMKHIGKKMOKGHEKKMGGKKMQ9OMKQ6OMQOOKMQNCOKMQQHGKMOKMGGKKMOIKGKMEKOKMQ9QOMQGMQOQQOQROQQCOMNQOQONKOKGKMOKMQGMKOKEIM9GKKM6HKMOBKMKOGKKHKMOCKOKMOKQQRQHMOKMQOMQOIM9KOEKQQOMOMKQOMOKMQHMOKQQOCOMKQOMQQHMOQQUQOM9Q7OM6QEIJFGGKKMOKMOKMKOGKKMOKMOCKQQOMOKQQOQRUQ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6983 5625 4957
Agility 721 138 20
Stamina 7590 5970 5780
Intellect 55 53 20
Spirit 85 85 20
Health 149215 126605 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 15.11% 15.11% 626
Spell Crit 13.79% 8.79% 1576
Spell Haste 17.66% 12.06% 1544
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16756 12380 190
Melee Hit 8.21% 8.21% 626
Melee Crit 16.75% 9.36% 1576
Melee Haste 12.06% 12.06% 1544
Expertise 26.91 26.91 808
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.94% 12.94% 886

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
tabard empty

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 3
Lichborne 0
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 3
Might of the Frozen Wastes 0
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_1h_T11_372_PTR
origin="http://chardev.org/?profile=75143"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
actions+=/presence,choose=unholy,if=buff.bloodlust.react
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
# Gear Summary # gear_strength=4957
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=808
# gear_hit_rating=626
# gear_crit_rating=1576
# gear_haste_rating=1544
# gear_mastery_rating=886
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_razorice

Death_Knight_Frost_2h_T11_372_PTR : 28962dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28962.2 14.47 / 0.05% 2142.6 13.5 13.6 runic_power 5.97% 59.8
Origin http://chardev.org/?profile=61432
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31611|23957|17270|7335|3778|1794|854&chds=0,63222&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31611++obliterate,C79C6E,0,0,15|t++23957++frost_strike,2459FF,1,0,15|t++17270++howling_blast,2459FF,2,0,15|t++7335++plague_strike,C79C6E,3,0,15|t++3778++melee_main_hand,C79C6E,4,0,15|t++1794++melee,C79C6E,5,0,15|t++854++melee,C79C6E,6,0,15&chtt=Death_Knight_Frost_2h_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:35,28,13,12,4,3,3,2,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|claw|blood_plague|melee|plague_strike|melee|claw&chtt=Death_Knight_Frost_2h_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:Qiy72qmpstusqrtutsrrsrpqqrqonoqsqnknonnmlllmlkjhhhjjihgffghhfcbdegihgfgggffeeeeeddccbcccbbaaaaaaZZZYYYYXYWWWXXXXWWVWXXXXWUSSSTUUVVWXaaZZZZZZZZYYXYYYYXXXXXYXXWWWWWXXXXVVVWVWVVVWWWWWWVUTTTTTUVWXXXWXXYabbaaZZZaZZYYYYYYYXXXXXXXXXXWWXXYYXWWWWWWWWWVUTTSSSTUUVVVVVVVVWVVWXYYZZZYXXYYYYXXWXXYXXXXXXXXXXXWXYYYXWWWVVUTSSSTTUUUUUVVVVWVVVWWWWXYYZZZZZZYYYZZZZZZZaabbbbbbccddcddefeedcccccdcccccccccbbbbbbabaaaabcdcccccbbbbbbaaaaaaZZZZZZZYYYXXWWVVUUUUUUUUUVVVVVVVVVVVW&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=124&chtt=Death_Knight_Frost_2h_T11_372_PTR+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:zz1123445557777778766543210zyxwvuuttssrrrqrrrqqqqqqppqopppopoopoooooonnnnmlmmllkkjjjiiihgggffffffffffffffffgghhhhiiijjjjjijjkkkkllllllllllkkkkkkjjiiihhgggffffeeeeeeeeeeeeeeedeeeefffgggghghhhiijjkkkklklllllllmlmlllllllmmlmlmlmlmmmmmmlmllllklllllllllllllkkkkjkjjjjiiiiihhhhhghhhhhhghhhhgggggggggggggfgfgggggghhiiijjkkkklkllllllllllllllllllllmmmmmmmmmmmmmmllllllllmmmmnnnooppqqrrssssssssrrqqqpppooooonnnnnnnnnoooooooooooonnnnnnnnnnnnnnnnnooooooopppppppppp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28962|max=45514&chxp=1,1,64,100&chtt=Death_Knight_Frost_2h_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,2,2,6,5,4,7,15,25,45,62,84,113,132,155,236,261,345,395,418,535,539,556,594,645,597,605,496,520,477,371,393,319,256,180,160,133,86,70,46,37,27,15,9,11,7,1,2&chds=0,645&chbh=5&chxt=x&chxl=0:|min=26034|avg=28962|max=31552&chxp=0,1,53,100&chtt=Death_Knight_Frost_2h_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T11_372_PTR 28962
blood_plague 789 2.7% 14.2 33.07sec 25129 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2119 4429 11.5% 0.0% 99.3%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.19 14.19 149.58 149.58 0.0000 3.0000 356660
Direct Results Count Pct Average Min Max Total Damage
hit 14.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 132.4 88.52% 2119.36 1647 3431 280634
crit 17.2 11.48% 4428.81 3441 7170 76026

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 7.0 66.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.01 7.01 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.0 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 307.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.94 1.94 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1029 3.6% 97.5 4.65sec 4772 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2750 5742 11.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
97.49 97.49 150.32 150.32 0.0000 3.0000 465193
Direct Results Count Pct Average Min Max Total Damage
hit 97.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.0 88.47% 2749.53 2128 4447 365646
crit 17.3 11.53% 5741.59 4447 9295 99548

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 10188 35.2% 191.0 2.35sec 24118 23957 18188 37491 56606 30.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
190.99 190.99 0.00 0.00 1.0067 0.0000 4606128
Direct Results Count Pct Average Min Max Total Damage
hit 132.1 69.19% 18187.92 14853 27479 2403320
crit 58.8 30.76% 37491.02 30597 56606 2202807
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage plus $s1 as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
howling_blast 3471 12.0% 90.2 4.95sec 17409 17270 15782 32990 54857 9.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.15 90.15 0.00 0.00 1.0081 0.0000 1569473
Direct Results Count Pct Average Min Max Total Damage
hit 81.6 90.54% 15781.97 12151 26247 1288260
crit 8.5 9.46% 32989.95 25396 54857 281213

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.48)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.48)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1369.63
  • base_dd_max:1513.20
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3772 13.0% 223.1 2.03sec 7644 3778 7583 15623 22335 6.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
223.09 223.09 0.00 0.00 2.0234 0.0000 1705248
Direct Results Count Pct Average Min Max Total Damage
hit 155.0 69.48% 7582.98 6319 10842 1175377
crit 14.4 6.46% 15623.42 13018 22335 225297
glance 53.6 24.01% 5686.75 4739 8132 304573
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 8012 27.7% 113.5 3.99sec 31912 31611 24438 50716 74903 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.51 113.51 0.00 0.00 1.0095 0.0000 3622423
Direct Results Count Pct Average Min Max Total Damage
hit 81.1 71.47% 24438.21 20050 36361 1982511
crit 32.3 28.49% 50716.48 41304 74903 1639912
miss 0.1 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage plus $s1. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.33 7.33 0.00 0.00 1.0143 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 61.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.89 7.89 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.9 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 112 0.4% 6.9 66.39sec 7405 7335 6936 14315 20756 6.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.86 6.86 0.00 0.00 1.0094 0.0000 50825
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 93.54% 6935.58 6148 10076 44532
crit 0.4 6.40% 14315.16 12665 20756 6293
miss 0.0 0.05% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 1446
claw 604 41.8% 13.0 2.78sec 1627 0 1491 2983 2983 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21151
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.73% 1491.43 1491 1491 17590
crit 1.2 9.18% 2982.86 2983 2983 3561
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 841 58.2% 24.0 1.44sec 1227 854 1189 2379 2379 9.3% 0.1% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 29445
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.59% 1189.27 1189 1189 19008
crit 2.2 9.26% 2378.55 2379 2379 5286
glance 5.8 24.06% 891.95 892 892 5151
dodge 0.0 0.03% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1627
claw 907 55.8% 110.0 3.68sec 3385 0 3101 6208 7643 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.04 110.04 0.00 0.00 0.0000 0.0000 372475
Direct Results Count Pct Average Min Max Total Damage
hit 99.8 90.71% 3101.46 2184 3822 309585
crit 10.1 9.21% 6207.90 4368 7643 62890
dodge 0.0 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 720 44.2% 135.4 2.97sec 2181 1794 2116 4231 5107 9.2% 0.1% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
135.44 135.44 0.00 0.00 1.2157 0.0000 295454
Direct Results Count Pct Average Min Max Total Damage
hit 90.3 66.64% 2115.69 1499 2553 190955
crit 12.5 9.21% 4230.54 2998 5107 52764
glance 32.6 24.07% 1587.18 1124 1915 51735
dodge 0.1 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_2h_T11_372_PTR
frost_strike runic_power 100.0% 753.7 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 84.6 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.3 89.1 0.0 1.5%
chill_of_the_grave runic_power 203.6 1988.2 9.8 2.4%
horn_of_winter runic_power 10.7 107.3 10.0 0.0%
improved_frost_presence runic_power 173.7 116.1 0.7 0.6%
might_of_the_frozen_wastes runic_power 100.3 981.3 9.8 2.1%
power_refund runic_power 0.1 2.7 28.8 0.0%
rune_abilities runic_power 173.7 2877.2 16.6 1.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 443.0 3.2 0.0%
pet - ghoul energy
energy_regen energy 668.1 4165.8 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.1 0.0 58.2sec 58.2sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 108.4sec 108.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 68.6 1.9 6.6sec 6.4sec 14% 22%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.9 0.0 61.3sec 61.3sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 47.8 3.3 9.4sec 8.8sec 19% 53%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 7.6 60.0 60.5sec 6.6sec 90% 88%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 125.5 0.0sec 3.6sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 85.3 5.2sec
runic_empowerment_wasted 0.6 98.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.56%
σ of the average dps 7.2350
2 * σ / μ 0.0500%
95% Confidence Intervall ( μ ± 2σ ) ( 28947.74 - 28976.68 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28940.50 - 28983.91 )
Sample Data
σ 723.4977
Minimum 26034.45
Maximum 31552.15
Spread ( max - min ) 5517.70
Range ( max - min ) / 2 2758.85
Range% 9.53
10th Percentile 28064.11
90th Percentile 29910.07
( 90th Percentile - 10th Percentile ) 1845.96
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2496
0.1 scale factor error with delta=300 4652
0.05 scale factor error with delta=300 18611
0.01 scale factor error with delta=300 465287
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J frost_strike,if=runic_power>=90&!buff.bloodlust.react
K frost_strike,if=runic_power>=95
L howling_blast,if=buff.rime.react
M howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
N obliterate
O empower_rune_weapon,if=target.time_to_die<=45
P frost_strike
Q howling_blast
R blood_tap
S empower_rune_weapon
T horn_of_winter

Sample Sequence

0123678B9EFFKKLGK5FKPNLKFKLKNKFKKNKNKLNKDKPFLPNPPMNPPRQPSEFFJJLPNJLFFJJP8PEBNJGJLNJLJNJLNJFJPPPQNPQPTPNPQQPDMPFPPRQPNPTPGLGJPP8NLPQP5NBLPNJNJLNJLGJJLNJNJGJGJPPNPQPNMPPDQPQHGPNLPPTNPNLPPA8FPNLPMPQPTGBLNJLPPNPQPNPQPMPQTPNPQPNPDNLPPNPNLPHPNMPP8PTNLN5JPPPNLNLPPNPBNPPQPMTNMJPNPPNLGPPQPNLMPPMPFLNJDJPRNLNJPP8PTGLNJMPPMNLMJPGLJNJPPQBPQNLPPMPQQNPPMPTPQGLPPSEFFJJLPGLADJNJ8JLJN5JLPNLGJLJGJPNLGJPPGLGJPNLBJNJLNJLHFJJLGJMJFJNJJMPFLJNJNJP8PDPNPTQMPPNPQNLJPNPQMPNLJPPNLNPBPQPNQPRQPTMPNLPMNPPQPPM8P6T5GPMMDPMPPNPNPQPMPTPNPMPGPMPBHGLPNPTPNPNLPAPNL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7677 6053 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150433 127767 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 8.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16895 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01% 15.01% 1257

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_2h_T11_372_PTR
origin="http://chardev.org/?profile=61432"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard=tabard_of_ramkahen,ilevel=85
# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T11_372 : 25587dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25587.2 10.15 / 0.04% 21.1 1214.0 1201.3 mana 0.00% 41.4
Origin http://chardev.org/?profile=34049
Talents http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
Glyphs
  • focus
  • rebirth
  • starfall
  • mark_of_the_wild
  • unburdened_rebirth
  • dash
  • starsurge
  • insect_swarm
  • moonfire

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:88905|82851|74497|43308|33082|16920|16100|1929&chds=0,177810&chco=336600,69CCF0,69CCF0,336600,8AD0B1,69CCF0,336600,C79C6E&chm=t++88905++sunfire,336600,0,0,15|t++82851++moonfire,69CCF0,1,0,15|t++74497++starfall,69CCF0,2,0,15|t++43308++insect_swarm,336600,3,0,15|t++33082++starsurge,8AD0B1,4,0,15|t++16920++starfire,69CCF0,5,0,15|t++16100++wrath,336600,6,0,15|t++1929++treant_melee,C79C6E,7,0,15&chtt=Druid_Balance_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:25,23,13,12,11,7,6,2,0,0&chds=0,100&chco=336600,69CCF0,8AD0B1,69CCF0,336600,336600,69CCF0,C79C6E,336600,C41F3B&chl=wrath|starfire|starsurge|moonfire|insect_swarm|sunfire|starfall|treant_melee|wild_mushroom_detonate|darkmoon_card_volcano&chtt=Druid_Balance_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:n00zzyxxw05777665443100zzyyxxyz0zyxwvvuttttssssstvxyzzzzzyyxxxwwwvvuuutuuuuvwxyyxxwwvvuuttttsssstuvwxxyyyyyyyxxxwwvvvuuuuuuvvwwwwwwwwvvuuutttsssssttuvwxxyyyxxxwwwvvvuuuttttuuvvwwwwwvvuuttssrrrrrrsssttuuvvvvvvuuutttssssrrrssstttuuuuutttssrrrrrrrrrrssttttuuuuutttsssrrrrrrrrrrrsssttttttssssrrrrrrrrrrsssttttttttssssrrrqqqqqqrrrrssttttttttttssssrrsssstttttuuttttttsssrrrqqqqqrrsstttuuuuuuutttttssssstttttttttttttssssrrrrrrrrssttuvvvvvvvvvvuuuuutttttttttuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=121010&chtt=Druid_Balance_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:xy34566665555784343345521zyyxwwvvvuutttsrqonmmmnnmmlmmmmmmmmlljjiiihgffffffffffeffghhhggggggghhhhhhijjjjkkkkllllkkkjjjjjjjjjjjjjjjjjjjjjjkjjjiiiiiihhhggggggggggfffeeeeeeddeefgghhijkklllmmlmmmnnmmmmlllkkjjjjjjjjjjjjjjjjjjjkjjkklmmnnnooonnnmmlkkkkjjiihggffeeeedddddddddeeeeffgghhiijkkllllllkkkjjihhhhggffffeeeeeffffffghhiijkllmnnoooooppppoonnmlkkjihgggfffffffffffgggghhiijklmmnnooooooooonnnnmllkjiihhggffeeeeeeefffgghhiijjklmnoopppqqqpppoonmmlllkjjiihhgg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25587|max=41810&chxp=1,1,61,100&chtt=Druid_Balance_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,1,7,8,9,19,24,34,54,70,105,144,174,200,353,323,388,433,503,495,508,591,553,620,594,519,488,466,388,352,322,275,225,185,145,113,76,80,50,32,24,16,8,8,6,5,1,3,1&chds=0,620&chbh=5&chxt=x&chxl=0:|min=23818|avg=25587|max=27545&chxp=0,1,47,100&chtt=Druid_Balance_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Balance_T11_372 25587
darkmoon_card_volcano 71 0.3% 10.2 46.38sec 3137 0 2679 4149 4882 31.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 32080
Direct Results Count Pct Average Min Max Total Damage
hit 7.0 68.67% 2679.26 2567 3160 18816
crit 3.2 31.26% 4149.37 3966 4882 13264
miss 0.0 0.07% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
insect_swarm 2855 11.2% 26.0 17.75sec 49683 43308 0 0 0 0.0% 0.1% 0.0% 0.0% 304 3416 5203 46.1% 0.0% 99.7%

Stats details: insect_swarm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.98 25.98 304.45 304.45 1.1472 1.4807 1290986
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 99.93% 0.00 0 0 0
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.0 53.86% 3415.51 2426 6463 560051
crit 140.5 46.14% 5203.23 3748 9985 730935

Action details: insect_swarm

Static Values
  • id:5570
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1490.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:$w1 Nature damage every $t1 sec.
  • description:The enemy target is swarmed by insects, causing $o1 Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:136.15
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
moonfire 3148 12.3% 15.4 30.21sec 92674 82851 4218 8898 15642 34.2% 0.1% 0.0% 0.0% 193 4591 9373 48.2% 0.0% 59.3%

Stats details: moonfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.36 15.36 193.39 193.39 1.1186 1.3855 1423183
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 65.74% 4218.37 2828 7484 42585
crit 5.2 34.18% 8897.92 5911 15642 46711
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.1 51.77% 4590.62 2956 8060 459585
crit 93.3 48.23% 9373.02 6179 16844 874303

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional ${$m1*6*$} Arcane damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 1631 6.4% 8.9 49.80sec 83188 74497 0 0 0 0.0% 0.0% 0.0% 0.0% 87 6380 13453 29.2% 0.1% 19.3%

Stats details: starfall

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.86 8.86 87.36 87.36 1.1167 1.0000 737327
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.8 70.73% 6379.78 4174 10868 394248
crit 25.5 29.19% 13452.81 8723 22714 343079
miss 0.1 0.07% 0.00 0 0 0

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.247000
  • base_dd_min:368.70
  • base_dd_max:428.49

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • tree:balance
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6522.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
starfire 5938 23.2% 81.8 5.44sec 32808 16920 20725 48016 81929 44.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.83 81.83 0.00 0.00 1.9390 0.0000 2684652
Direct Results Count Pct Average Min Max Total Damage
hit 45.5 55.59% 20724.83 14752 39200 942803
crit 36.3 44.33% 48015.63 30831 81929 1741849
miss 0.1 0.07% 0.00 0 0 0

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:986.98
  • base_dd_max:1230.95
starsurge 3418 13.4% 37.4 12.12sec 41297 33082 26464 60782 99907 43.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.42 37.30 0.00 0.00 1.2483 0.0000 1545442
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 56.25% 26464.33 17897 47803 555288
crit 16.3 43.67% 60782.21 37405 99907 990154
miss 0.0 0.08% 0.00 0 0 0

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:1017.72
  • base_dd_max:1405.43
sunfire 1748 6.8% 7.9 57.11sec 100415 88905 4994 10516 15642 33.7% 0.1% 0.0% 0.0% 96 5345 11267 38.9% 0.0% 30.7%

Stats details: sunfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.87 7.87 96.30 96.30 1.1295 1.4427 790340
Direct Results Count Pct Average Min Max Total Damage
hit 5.2 66.21% 4994.36 4347 7484 26026
crit 2.7 33.71% 10516.19 9086 15642 27905
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 58.9 61.13% 5345.20 4544 8060 314635
crit 37.4 38.87% 11267.03 9497 16844 421774

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional ${$m1*6*$} Nature damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 82 0.3% 1.0 0.00sec 36982 0 31920 49316 49316 29.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 36982
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 70.73% 31919.59 31920 31920 22577
crit 0.3 29.21% 49315.76 49316 49316 14405
miss 0.0 0.06% 0.00 0 0 0

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.603200
  • base_dd_min:845.04
  • base_dd_max:1022.45
wrath 6313 24.7% 121.6 3.60sec 23480 16100 15311 34711 58152 42.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.56 121.18 0.00 0.00 1.4584 0.0000 2854334
Direct Results Count Pct Average Min Max Total Damage
hit 69.5 57.39% 15310.67 10425 27824 1064726
crit 51.6 42.54% 34711.46 21789 58152 1789608
miss 0.1 0.07% 0.00 0 0 0

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]$?s33891[ |C0033AA11Tree of Life: Cast time reduced by 50%, damage increased by 30%.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:675.17
  • base_dd_max:761.36
pet - treants 450
treant_melee 450 100.0% 60.8 6.39sec 2860 1929 3037 6072 7511 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: treant_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
60.75 60.75 0.00 0.00 1.4829 0.0000 173752
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 75.75% 3036.96 2754 3755 139764
crit 0.1 0.20% 6072.34 5507 7511 752
glance 14.6 24.01% 2278.09 2065 2817 33236
dodge 0.0 0.03% 0.00 0 0 0

Action details: treant_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.65
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Druid_Balance_T11_372
insect_swarm mana 6.8% 34.4 1445
moonfire mana 4.6% 57.0 1627
starfall mana 10.2% 13.1 6326
starfire mana 26.1% 18.7 1752
starsurge mana 12.3% 22.9 1800
sunfire mana 2.3% 61.7 1627
wrath mana 33.6% 15.5 1517
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29076.0 16.1 1.4%
euphoria mana 18.6 348114.5 18710.0 3.9%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101560.0 101560.0 0.0%
innervate mana 16.4 23430.9 1425.4 23.7%
mp5_regen mana 1809.3 83033.4 45.9 1.4%
omen_of_clarity none 21.4 40827.2 1907.1 0.0%
replenishment mana 1809.3 53654.3 29.7 1.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.2sec 104.2sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 220.3 0.0 2.0sec 2.0sec 78% 78%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
innervate 0.4 0.0 221.1sec 221.1sec 1% 100%

Database details

  • id:
  • cooldown name:buff_innervate
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.9sec 51.9sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
lunar_eclipse 9.1 0.0 49.4sec 49.4sec 27% 55%

Database details

  • id:48518
  • cooldown name:buff_lunar_eclipse
  • tooltip:Damage done by your arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_shower 23.2 0.0 19.9sec 19.9sec 15% 16%

Database details

  • id:81192
  • cooldown name:buff_lunar_shower
  • tooltip:Direct damage of your Moonfire increased by $s1%, and mana cost reduced by $s2%.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 19.4 0.0 23.9sec 23.9sec 63% 65%

Database details

  • id:
  • cooldown name:buff_natures_grace
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
omen_of_clarity 21.5 0.9 20.1sec 19.3sec 9% 10%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
power_torrent_mh 10.1 0.0 47.1sec 47.1sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shooting_stars 22.0 1.7 19.9sec 18.4sec 9% 57%

Database details

  • id:93400
  • cooldown name:buff_shooting_stars
  • tooltip:Cast time of your next Starsurge reduced by $s1%.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:4.00%
solar_eclipse 9.6 0.0 48.7sec 48.7sec 32% 54%

Database details

  • id:48517
  • cooldown name:buff_solar_eclipse
  • tooltip:Damage done by your nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_caster 18.6 0.0 24.4sec 24.4sec 24% 20%

Database details

  • id:
  • cooldown name:buff_t11_4pc_caster
  • tooltip:(null)
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
volcanic_potion 2.0 0.0 414.4sec 414.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
treants-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
moonkin_form

Database details

  • id:24858
  • cooldown name:buff_moonkin_form
  • tooltip:Arcane and Nature spell damage increased by $24905s3%. Immune to Polymorph effects. All damage reduced by $24905s1%. Spell haste of all party and raid members increased by $24907s1%
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
unaligned_eclipse_gain 0.3 160.1sec
wrong_eclipse_starfire 1.0 144.1sec
wrong_eclipse_wrath 3.4 97.6sec

Statistics & Data Analysis

DPS
Population
Convergence 70.52%
σ of the average dps 5.0756
2 * σ / μ 0.0397%
95% Confidence Intervall ( μ ± 2σ ) ( 25577.02 - 25597.32 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25571.95 - 25602.40 )
Sample Data
σ 507.5574
Minimum 23817.98
Maximum 27544.52
Spread ( max - min ) 3726.55
Range ( max - min ) / 2 1863.27
Range% 7.28
10th Percentile 24968.33
90th Percentile 26271.55
( 90th Percentile - 10th Percentile ) 1303.21
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1573
0.1 scale factor error with delta=300 2289
0.05 scale factor error with delta=300 9159
0.01 scale factor error with delta=300 228990
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 moonkin_form
4 snapshot_stats
5 volcanic_potion,if=!in_combat
6 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
7 faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
8 wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
9 berserking
A insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
B starsurge,if=buff.t11_4pc_caster.up
C starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
D wrath,if=buff.t11_4pc_caster.up
E wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
F wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
G typhoon,moving=1
H starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
I sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
J moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
K starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
L innervate,if=mana_pct<50
M treants,time>=5
N starfire,if=eclipse_dir=1&eclipse<80
O starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
P wrath,if=eclipse_dir=-1&eclipse>=-87
Q wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
R starfire,if=eclipse_dir=1
S wrath,if=eclipse_dir=-1
T starfire
U wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
V moonfire,moving=1
W sunfire,moving=1

Sample Sequence

013589AJKTTMNNQDDPPPPAPKIPPKPPPOCCHKANNNJNNNNQBADDPPIPPKPKPPAPKPBCCCHJNAKNNNKNQDDDDAIPKPPPPPPPPABCCCHJNNNKANKRDDKIPPKPKAPPPPPPPJSBCAC9HNNNJMNNKNARQBDPIPPKPAPPPPPPPJSBCAHNNNNJKNNNARQDDKPIPPPAPPPPPKPCCCAHJNNKNNNNNADDDBIPPKPAPPPPPPPJLBCACHNNNJNKNNARQDDD9PIKPPMAPPPPPPPOBCHJAKNNNNNNQDBAIPPPPPPPPKPAKSCBHJNNNNANNKNJRQDDPAPPKPPIPPPPPPASBCCCHJNNANKNNNQBD6IPPAPPPPPKPPPJPASCCCB9HNJN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 699 117 20
Agility 693 111 20
Stamina 7714 6088 5862
Intellect 6003 5283 4595
Spirit 1765 1765 1591
Health 147199 124505 0
Mana 107410 97600 0
Spell Power 9020 7480 2207
Spell Hit 16.93% 16.93% 143
Spell Crit 24.44% 18.33% 778
Spell Haste 23.87% 17.97% 2301
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 1797 469 0
Melee Hit 1.19% 1.19% 143
Melee Crit 18.94% 12.15% 778
Melee Haste 17.97% 17.97% 2301
Expertise 0.00 0.00 0
Armor 14998 10922 10922
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 7.80% 5.41% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.35% 14.35% 1138

Gear

Encoded
head stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2 security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
tabard empty

Talents

Balance Rank
Nature's Grace 3
Starlight Wrath 3
Nature's Majesty 2
Genesis 3
Moonglow 1
Balance of Power 2
Euphoria 2
Moonkin Form 1
Typhoon 1
Shooting Stars 2
Owlkin Frenzy 0
Gale Winds 2
Solar Beam 0
Dreamstate 2
Force of Nature 1
Sunfire 1
Earth and Moon 1
Fungal Growth 0
Lunar Shower 3
Starfall 1
Feral Rank
Feral Swiftness 0
Furor 0
Predatory Strikes 0
Infected Wounds 0
Fury Swipes 0
Primal Fury 0
Feral Aggression 0
King of the Jungle 0
Feral Charge 0
Stampede 0
Thick Hide 0
Leader of the Pack 0
Brutal Impact 0
Nurturing Instinct 0
Primal Madness 0
Survival Instincts 0
Endless Carnage 0
Natural Reaction 0
Blood in the Water 0
Rend and Tear 0
Pulverize 0
Berserk 0
Restoration Rank
Blessing of the Grove 2
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 2
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Balance_T11_372
origin="http://chardev.org/?profile=34049"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
glyphs=focus/rebirth/starfall/mark_of_the_wild/unburdened_rebirth/dash/starsurge/insect_swarm/moonfire
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/moonkin_form
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
actions+=/berserking
actions+=/insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
actions+=/starsurge,if=buff.t11_4pc_caster.up
actions+=/starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
actions+=/wrath,if=buff.t11_4pc_caster.up
actions+=/wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/typhoon,moving=1
actions+=/starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
actions+=/sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
actions+=/moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
actions+=/starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
actions+=/innervate,if=mana_pct<50
actions+=/treants,time>=5
actions+=/starfire,if=eclipse_dir=1&eclipse<80
actions+=/starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
actions+=/wrath,if=eclipse_dir=-1&eclipse>=-87
actions+=/wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
actions+=/starfire,if=eclipse_dir=1
actions+=/wrath,if=eclipse_dir=-1
actions+=/starfire
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
actions+=/moonfire,moving=1
actions+=/sunfire,moving=1
head=stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
chest=scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist=belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs=stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet=nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists=manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands=stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2=security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5862
# gear_intellect=4595
# gear_spirit=1591
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=778
# gear_haste_rating=2301
# gear_mastery_rating=1138
# gear_armor=10922
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Druid_Feral_T11_372 : 24988dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24987.7 10.35 / 0.04% 1613.0 15.5 15.3 energy 47.00% 34.3
Origin http://chardev.org/?profile=35492
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:65898|33469|32168|21170|14021|4818&chds=0,131797&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++65898++rake,C55D54,0,0,15|t++33469++ravage,C79C6E,1,0,15|t++32168++ferocious_bite,C79C6E,2,0,15|t++21170++shred,C79C6E,3,0,15|t++14021++mangle_cat,C79C6E,4,0,15|t++4818++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,20,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|rake|cat_melee|fury_swipes|mangle_cat|ferocious_bite|ravage&chtt=Druid_Feral_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:puiku47700zyvrponnlkjihgedbZXWXemnlhdaYWVUUUUTTSSTTSSTTTTTVcgfecZXWVUUUUTTTTSSSSSTTTTUYdffdbZYXWVUUUUTTTTTSSSSSTTVYceecbZXVUUUTTTTTTTTTTSSSSTVZcedcaZYWVUTTTTTTTTTTTTUTTUWZdeedcaYXWVUUTTTTTTTTTTTTTUWZcdddcddeedcbZXWVUTSRRRSSSUWYaccbaZXWWVUUUUUTTTTTTTTTUVXabccbaZYXWVUUUUUUTTTTSSSTUVXZbbbaZYXWVUUUTTTTTTTTTSSTUVXZabbaZYXWVUUTTTTTTTTTTTTTUVXZbbbbaYXXVVUTTTTTTTTTTTTTUVXZaabaZYXWVVUUTTTSSSSSSSTUUVXYZabbbcccbbZYXVUTSRRRRRSSTVWYZZZZYXWVVUUUTTTTTTSSSSTTUVXYZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Druid_Feral_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qsuxyyyzz00124577765320zyxwwvvutsrppnnmlllkkjjihgggggghhhhiiijjjkjjjjjihhhhggghhhiiiiiiijjjjkkkkkjiihgggggghhiiiiiiiiiiiiiijiiihggfffffgghhhhhhhhhhhhhhhihhhhggggggghhijjjjjkkjjjjjjjjjiiihhgggggghhiijjkllmmmnnnnoooonnnnnmmmllllllkkkkkjjjjiiihhhhhhhhiiiiiiiiijjjjjjjjiihhggggghhhhhhhhhhhiiiiiiiihhggffffffgggghhhhhhhhhhhhiihhhhggggggghhiiiijjjjiiijjiiiiihhhggggggggghhhhhhhhhhhhhhggggggggggggghhijjklmmnnooooooooooooonnnmlllkkjjjjiiiihhgggfffffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24988|max=41877&chxp=1,1,60,100&chtt=Druid_Feral_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,4,1,6,9,13,20,41,57,84,99,130,176,240,273,311,388,424,445,551,560,585,589,650,598,558,494,480,428,335,297,241,211,164,128,113,85,64,41,35,21,15,11,7,2,8,5,1,0,1&chds=0,650&chbh=5&chxt=x&chxl=0:|min=23215|avg=24988|max=27094&chxp=0,1,46,100&chtt=Druid_Feral_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372 24988
berserk 0 0.0% 2.8 195.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0164 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Mangle (Bear) can hit up to $58923s1 targets with no cooldown. Reduces the energy cost of your Cat Form abilities by $s1%.
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4815 19.3% 547.5 0.83sec 3977 4818 2922 6048 7505 49.5% 10.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.54 547.54 0.00 0.00 0.8255 0.0000 2177669
Direct Results Count Pct Average Min Max Total Damage
hit 85.8 15.66% 2921.60 1848 3643 250545
crit 270.8 49.46% 6048.40 3807 7505 1638008
glance 131.4 24.01% 2199.46 1386 2732 289116
dodge 35.6 6.51% 0.00 0 0 0
miss 23.9 4.37% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 670 2.7% 9.2 51.21sec 32771 32168 20062 42178 73912 67.3% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.25 9.25 0.00 0.00 1.0188 0.0000 302989
Direct Results Count Pct Average Min Max Total Damage
hit 2.0 21.88% 20062.36 2977 35880 40582
crit 6.2 67.29% 42178.05 6107 73912 262407
dodge 0.6 6.53% 0.00 0 0 0
miss 0.4 4.30% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 950 3.8% 51.7 8.72sec 8315 0 6109 12630 15510 44.1% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.65 51.65 0.00 0.00 0.0000 0.0000 429488
Direct Results Count Pct Average Min Max Total Damage
hit 23.3 45.01% 6109.38 5729 7529 142044
crit 22.8 44.06% 12629.99 11801 15510 287443
dodge 3.4 6.56% 0.00 0 0 0
miss 2.3 4.37% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat Form or Bear Form, you have a chance to cause a Fury Swipe dealing $80861s2% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 706 2.8% 22.2 20.67sec 14382 14021 10521 21709 25644 44.7% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.19 22.19 0.00 0.00 1.0258 0.0000 319170
Direct Results Count Pct Average Min Max Total Damage
hit 9.9 44.48% 10520.96 9610 12449 103852
crit 9.9 44.69% 21708.66 19797 25644 215317
dodge 1.4 6.44% 0.00 0 0 0
miss 1.0 4.39% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 5000 20.0% 33.5 13.53sec 67598 65898 1884 3895 4670 44.3% 10.8% 0.0% 0.0% 146 9730 20127 49.5% 0.0% 96.1%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.45 33.45 146.24 146.24 1.0258 2.9726 2261290
Direct Results Count Pct Average Min Max Total Damage
hit 15.0 44.88% 1884.36 1778 2267 28288
crit 14.8 44.30% 3895.43 3663 4670 57731
dodge 2.2 6.51% 0.00 0 0 0
miss 1.4 4.32% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.9 50.51% 9729.65 9157 12018 718711
crit 72.4 49.49% 20127.28 18864 24756 1456561

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 75 0.3% 1.0 0.00sec 33771 33469 22989 47392 47613 54.2% 10.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0090 0.0000 33767
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 35.11% 22988.71 20098 23113 8071
crit 0.5 54.23% 47392.17 41403 47613 25696
dodge 0.1 6.28% 0.00 0 0 0
miss 0.0 4.38% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6431 25.7% 19.7 22.67sec 147425 143939 0 0 0 0.0% 10.7% 0.0% 0.0% 200 9507 19669 49.9% 0.0% 88.2%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.73 19.73 199.54 199.54 1.0242 2.0000 2908065
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 89.27% 0.00 0 0 0
dodge 1.3 6.41% 0.00 0 0 0
miss 0.9 4.32% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.0 50.14% 9507.19 8719 11527 951123
crit 99.5 49.86% 19669.07 17962 23746 1956942

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.98 13.98 0.00 0.00 1.0256 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6341 25.4% 132.5 3.36sec 21639 21170 15895 32869 39324 44.1% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.52 132.52 0.00 0.00 1.0222 0.0000 2867659
Direct Results Count Pct Average Min Max Total Damage
hit 59.7 45.02% 15895.05 15022 19089 948343
crit 58.4 44.06% 32869.00 30946 39324 1919316
dodge 8.6 6.52% 0.00 0 0 0
miss 5.8 4.40% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.49 16.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372
feral_charge_cat energy 0.1% 0.0 10
ferocious_bite energy 5.4% 807.2 41
mangle_cat energy 10.2% 447.2 32
rake energy 14.3% 2252.5 30
rip energy 7.5% 5533.9 27
savage_roar energy 4.8% 0.0 24
shred energy 57.7% 709.7 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 88.9 568.3 6.4 0.0%
energy_regen energy 1809.3 4983.5 2.8 0.1%
omen_of_clarity none 28.2 1080.1 38.3 0.0%
tigers_fury energy 16.5 989.4 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.7sec 195.7sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.3 137.3 11.3sec 2.5sec 78% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 56.1sec 56.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 28.2 0.3 15.6sec 15.4sec 3% 4%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.3sec 81.3sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.8sec 23.8sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 80.6sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:32.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee 1.7 18.1 164.4sec 23.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 28.0sec 28.0sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.0sec 414.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.6 7.9sec
fury_swipes 51.7 8.7sec
primal_fury 83.7 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.61%
σ of the average dps 5.1767
2 * σ / μ 0.0414%
95% Confidence Intervall ( μ ± 2σ ) ( 24977.37 - 24998.08 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24972.20 - 25003.26 )
Sample Data
σ 517.6659
Minimum 23214.58
Maximum 27093.83
Spread ( max - min ) 3879.26
Range ( max - min ) / 2 1939.63
Range% 7.76
10th Percentile 24337.22
90th Percentile 25669.20
( 90th Percentile - 10th Percentile ) 1331.97
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1716
0.1 scale factor error with delta=300 2382
0.05 scale factor error with delta=300 9528
0.01 scale factor error with delta=300 238202
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBB9JMRLSSFSISSSKPSSLSSSSSSSB9KSSISMLSKKSSBI9KSLSSMSKSSSBI9SSKSPSSKSMB9SSISKSSSKSI9BBBBMKQQLSIKS9SSSBNKSSSSIISSKSS9SBBSFSSSIKSSSLSMSSSK9SBSSISSKSSNSSL9KBISSSKSSI9SBKKSMSSSSSSKISS9SBSKLSSMSKSB9ISSKSNSSKKI9BSSSSKSSLISK9BMSSFSSSSKSSGLSSLSIII9BJSSHSKMLSLISSS9BHJSSSNKSL9BBISSSKSHHLSSKHSS9BBSASISMKSSHK9GBSMS

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7051 5457 5366
Stamina 7698 6073 5847
Intellect 191 182 20
Spirit 192 192 20
Health 146975 124295 0
Mana 24400 24245 0
Spell Power 199 172 0
Spell Hit 4.26% 4.26% 436
Spell Crit 20.54% 15.53% 2222
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 24067 829 190
Melee Hit 3.63% 3.63% 436
Melee Crit 51.57% 37.66% 2222
Melee Haste 3.97% 3.97% 508
Expertise 0.00 0.00 0
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.65% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.98% 19.98% 2148

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372
origin="http://chardev.org/?profile=35492"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5366
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=436
# gear_crit_rating=2222
# gear_haste_rating=508
# gear_mastery_rating=2148
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Druid_Feral_T11_372_hitcap : 24951dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24951.1 10.30 / 0.04% 1700.2 14.7 14.5 energy 48.86% 33.2
Origin http://chardev.org/?profile=35430
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:68665|34841|33445|22054|14543|4883&chds=0,137330&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++68665++rake,C55D54,0,0,15|t++34841++ravage,C79C6E,1,0,15|t++33445++ferocious_bite,C79C6E,2,0,15|t++22054++shred,C79C6E,3,0,15|t++14543++mangle_cat,C79C6E,4,0,15|t++4883++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372_hitcap+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,20,19,4,3,3,0&chds=0,100&chco=C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=shred|rip|cat_melee|rake|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372_hitcap+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:mqdiv574utttoligfedcaZYWWVVUSSVenlgbYWUTTSTTSSRRRSSRRSSSSRVdgdaYVUUUTSTTSSSRQRRRSSSSSTZefdaXWVUTTTSTSSSSSRRRRRSSSUZddbZXWUSSSRSSSSSSSSSSRRRRSVZccaYXWUTSSRRRSSSSSSSSSSSSTXbddcaYWVUTTSSRRSSSSSSSSSSSTXaccbaZbccbaYWUTSRQPPPPQQRSUWZaaZYXVUTTTTSSSSRRRRRSSSSTVYabbaYXWVUTTTSSSSSSRRRRRSSTVXZaaZXWVUTSSSSSSSSSSSRRRRSTVXZaaYXWVUTSSSSSSSSSSSSSSSSUWYZaaYXWVUTTSSSRRRRRSSSSSSTUWXYZZYXWVUTTSSSRRRRRRRRSSSTVWXZZZZZaaaZYWVTSRQPPPPPPQRSUWXYYXWWVUTTSSSSSSSRRRRRRRSTVXXYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=73&chtt=Druid_Feral_T11_372_hitcap+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwyzzzzz1023457765321zywwvvutsrqponmmlkkkjjihggffgfggggghhiiiijjjjiiihgggfffggghhhhhhhiiijjjjjjjihgffffffgghhhhhhhhhhhhiiiiihhgfeeeeeffggghhhhgggggghhhhhgggfffffgghhiijjjjjjjjjiijjiihhgggfffffgghhijjkklllmmmnnnnnmmmmmmlllkkkkkjjjjjjiiihhhggggggghhhhhhhhiiiiiiiiiihhggfffffggghhhhhhhhhhhhhhhhhggffeeeefffggggggggggghhhhhhhgggfffffgghhhiiiiiiiiiiiiihhhgggfffffffgggggghhhggggggggfffffffffffgghiijkllmnnnoooooonnnnnnmmllkkjjjiiiihhhhggfffeeeffffffffffffg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24951|max=42671&chxp=1,1,58,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,3,3,0,6,11,18,30,39,54,91,118,163,204,272,294,373,440,480,562,583,568,601,607,610,560,561,484,423,368,301,276,200,154,147,100,96,52,41,30,28,17,12,5,3,5,2,1,2&chds=0,610&chbh=5&chxt=x&chxl=0:|min=23045|avg=24951|max=27005&chxp=0,1,48,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372_hitcap 24951
berserk 0 0.0% 2.8 195.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.77 2.77 0.00 0.00 1.0171 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Mangle (Bear) can hit up to $58923s1 targets with no cooldown. Reduces the energy cost of your Cat Form abilities by $s1%.
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4881 19.6% 547.6 0.83sec 4030 4883 2920 6038 7485 44.8% 3.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.61 547.61 0.00 0.00 0.8254 0.0000 2207108
Direct Results Count Pct Average Min Max Total Damage
hit 149.4 27.28% 2920.01 1843 3633 436134
crit 245.5 44.83% 6038.39 3796 7485 1482447
glance 131.4 24.00% 2195.09 1382 2725 288528
dodge 21.3 3.89% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 681 2.7% 9.0 53.53sec 34096 33445 19831 41868 73687 68.2% 3.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.03 9.03 0.00 0.00 1.0195 0.0000 308024
Direct Results Count Pct Average Min Max Total Damage
hit 2.5 28.01% 19831.50 2960 35770 50188
crit 6.2 68.17% 41867.50 6086 73687 257837
dodge 0.3 3.82% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 1043 4.2% 54.5 8.28sec 8656 0 6093 12597 15468 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.47 54.47 0.00 0.00 0.0000 0.0000 471480
Direct Results Count Pct Average Min Max Total Damage
hit 28.9 53.01% 6093.34 5712 7509 175922
crit 23.5 43.08% 12596.64 11766 15468 295558
dodge 2.1 3.92% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat Form or Bear Form, you have a chance to cause a Fury Swipe dealing $80861s2% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 669 2.7% 20.2 22.82sec 14962 14543 10486 21635 25582 43.8% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 0.00 0.00 1.0288 0.0000 302751
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 52.32% 10486.34 9586 12419 111007
crit 8.9 43.80% 21634.95 19746 25582 191744
dodge 0.8 3.88% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4865 19.5% 31.2 14.57sec 70581 68665 1888 3906 4676 43.2% 3.9% 0.0% 0.0% 147 9742 20158 44.8% 0.0% 96.6%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.17 31.17 146.88 146.88 1.0279 2.9742 2200011
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 52.94% 1888.23 1780 2270 31160
crit 13.5 43.19% 3905.55 3667 4676 52580
dodge 1.2 3.87% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 81.1 55.21% 9741.80 9160 12026 789961
crit 65.8 44.79% 20158.34 18870 24774 1326310

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 78 0.3% 1.0 0.00sec 35141 34841 23025 47428 47499 53.3% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0086 0.0000 35141
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 42.85% 23024.84 20050 23058 9866
crit 0.5 53.29% 47428.20 41304 47499 25274
dodge 0.0 3.86% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6257 25.1% 18.4 24.47sec 154179 150266 0 0 0 0.0% 3.9% 0.0% 0.0% 200 9531 19723 45.2% 0.0% 88.5%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.35 18.35 200.09 200.09 1.0260 2.0000 2829717
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 96.14% 0.00 0 0 0
dodge 0.7 3.86% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 109.6 54.75% 9531.01 8726 11539 1044186
crit 90.5 45.25% 19722.80 17976 23771 1785531

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 1.0259 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6477 26.0% 129.8 3.44sec 22569 22054 15869 32820 39230 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
129.79 129.79 0.00 0.00 1.0234 0.0000 2929204
Direct Results Count Pct Average Min Max Total Damage
hit 68.8 52.99% 15869.38 14983 19043 1091301
crit 56.0 43.15% 32820.17 30865 39230 1837903
dodge 5.0 3.87% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.6 27.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.55 16.55 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.6 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372_hitcap
feral_charge_cat energy 0.2% 0.0 10
ferocious_bite energy 5.6% 833.3 41
mangle_cat energy 9.8% 466.8 32
rake energy 13.9% 2388.0 30
rip energy 7.3% 5833.7 26
savage_roar energy 5.1% 0.0 24
shred energy 58.2% 757.7 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 31.5 191.1 6.1 0.0%
energy_regen energy 1809.3 4985.0 2.8 0.0%
omen_of_clarity none 30.5 1170.7 38.4 0.0%
tigers_fury energy 16.6 993.2 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.3sec 195.3sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.8 138.9 11.2sec 2.5sec 79% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.7sec 55.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 30.5 0.3 14.5sec 14.3sec 3% 5%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.7sec 23.7sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.0 80.0sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:42.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee 1.4 18.0 169.5sec 23.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.6 0.0 27.9sec 27.9sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.0sec 414.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.2 7.7sec
fury_swipes 54.5 8.3sec
primal_fury 78.9 5.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.92%
σ of the average dps 5.1512
2 * σ / μ 0.0413%
95% Confidence Intervall ( μ ± 2σ ) ( 24940.81 - 24961.42 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24935.66 - 24966.57 )
Sample Data
σ 515.1250
Minimum 23044.99
Maximum 27004.58
Spread ( max - min ) 3959.59
Range ( max - min ) / 2 1979.79
Range% 7.93
10th Percentile 24308.49
90th Percentile 25628.32
( 90th Percentile - 10th Percentile ) 1319.83
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1704
0.1 scale factor error with delta=300 2358
0.05 scale factor error with delta=300 9434
0.01 scale factor error with delta=300 235869
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBIKM9LRSSSPFSSSKSNSSSSSSSSIBBK9SSSSSKLISLSM9BBBJSSSISKSSN9SSBKISSSKSS9SLBIKSSMSKLS9IBSSKLSNSSSKSI9SBSSPKLSSSISM9JBSSFSSSSSKSISSSM9KBLSSSIKSSSNS9BKSSILSKSSSB9SSIIJMSLSKSB9ISSSMKSSSLSSIB9JSSSSMKSSB9IKSSSPSKSSM9BSLKIFSSSSSPPSSKKHSSB9ISSKHSMSKSIIB9SSSHKMSSGKB9SISSKMSSSK9BISASSHKSSNSB9KSSISO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7018 5427 5336
Stamina 7698 6073 5847
Intellect 191 182 20
Spirit 192 192 20
Health 146975 124295 0
Mana 24400 24245 0
Spell Power 199 172 0
Spell Hit 9.38% 9.38% 961
Spell Crit 16.00% 10.99% 1408
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 23967 829 190
Melee Hit 8.00% 8.00% 961
Melee Crit 46.93% 33.03% 1408
Melee Haste 3.97% 3.97% 508
Expertise 10.42 10.42 313
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.56% 24.22% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 20.18% 20.18% 2184

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372_hitcap
origin="http://chardev.org/?profile=35430"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5336
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=313
# gear_hit_rating=961
# gear_crit_rating=1408
# gear_haste_rating=508
# gear_mastery_rating=2184
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Hunter_BM_T11_372 : 27999dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27998.8 8.36 / 0.03% 2637.9 10.6 10.5 focus 0.00% 60.8
Origin http://chardev.org/?profile=34113
Talents http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
Glyphs
  • bestial_wrath
  • kill_command
  • arcane_shot
  • kill_shot

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31804|26124|16086|10221|7182|4309|2896&chds=0,63607&chco=C79C6E,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E&chm=t++31804++kill_command,C79C6E,0,0,15|t++26124++kill_shot,C79C6E,1,0,15|t++16086++arcane_shot,69CCF0,2,0,15|t++10221++cobra_shot,336600,3,0,15|t++7182++claw,C79C6E,4,0,15|t++4309++ranged,C79C6E,5,0,15|t++2896++melee,C79C6E,6,0,15&chtt=Hunter_BM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:19,18,17,15,13,10,4,3&chds=0,100&chco=69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=arcane_shot|cobra_shot|kill_command|ranged|claw|melee|serpent_sting|kill_shot&chtt=Hunter_BM_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x832zwwqmlpy1sqz233tqx222vrx123wqv023xrv023yrv024zsv024zsswz22yusw122zurrnjhcXWVYgggntx1zuuw021xuux120xtuz110vswz12zutwz22yvtw021zusx012yttwz20vsojieZXXclswusuz112vswz12zttwz21xuux110xtvz110vswz02zttwz21yutw011ztrrokhdYXWYddfmrv0zvvwy11zwuvz100vtxz01yuvxz20wvvx11zxvvz00zvuxz01yuvxz10wtpljfbZYaiptusuy001xuwy020wvwy11zxvwz000xvxz01zwwxz11yxwy220zyz2200yyzyvtqmkhefgjptvyxwyzz10xxyy01zzxxz000yxzzz10yyzz10zzyy0000zyz0z1zyzzz10yxurqolkiimqsvwwz0010yzzz10&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=92&chtt=Hunter_BM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:62375543353302121zvvuuvupqqrqpmmnppommnooommnppommmmnnmllllmllmmmonnnoppponnnnopommmmmlkkjjkkkjjkkklkkkkkkkjjjjkkkkkkkkkkkkkkkkkkkkllmmmmnooonnnnnonmmnnnnlkkkkkjiijjkkkkkkkllkkkkkllkkkkklkkkkkjkjjjjjjjjjkllmmmnnnoonmmnnnnnmmlllkkjjiijjjjkkkkkkllllllllllllllllllkkkkkkkkjjjkkllmmnnooooooooonnnoonmlllkkjjjjjjkjkkkkkkkkkkkkkkkklllllllmmmnnnnoopppqrrsssttuuutssssssrrrqqpoonnmmmmmmmmmmmmmmmlllmmmmmmmmmmmmmmmmnnnnnnnoppqrrsttuvvvvvvvvvvvvutssrqqqoopoopooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27999|max=42394&chxp=1,1,66,100&chtt=Hunter_BM_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,5,5,4,16,22,23,39,63,84,121,164,196,274,311,384,455,520,591,573,589,629,654,563,564,567,504,407,331,313,217,198,152,113,79,87,71,31,24,21,13,5,3,4,2,1,2,0,1&chds=0,654&chbh=5&chxt=x&chxl=0:|min=26506|avg=27999|max=29783&chxp=0,1,46,100&chtt=Hunter_BM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_BM_T11_372 27999
arcane_shot 5245 18.7% 146.2 3.08sec 16219 16086 11693 24243 31559 36.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.19 145.92 0.00 0.00 1.0083 0.0000 2371119
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 63.70% 11693.31 10837 15320 1086862
crit 53.0 36.30% 24243.21 22323 31559 1284257

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 70.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:70.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped unless killed.
cobra_shot 4916 17.6% 178.5 2.47sec 12449 10221 9031 18654 23032 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.52 178.18 0.00 0.00 1.2179 0.0000 2222370
Direct Results Count Pct Average Min Max Total Damage
hit 114.5 64.24% 9031.47 8766 11181 1033807
crit 63.7 35.76% 18653.97 18059 23032 1188564

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
fervor 0 0.0% 1.7 156.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fervor

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.71 1.71 0.00 0.00 1.0052 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.7 100.00% 0.00 0 0 0

Action details: fervor

Static Values
  • id:82726
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly restores $s1 Focus to you and your pet.
focus_fire 0 0.0% 25.6 17.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.64 25.64 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 25.6 100.00% 0.00 0 0 0

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy Effect stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy Effect stack consumed. Lasts for $d.
kill_command 4813 17.2% 68.0 6.68sec 31984 31804 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.03 68.03 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 68.0 100.00% 0.00 0 0 0

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:37.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Give the command to kill, causing your pet to instantly inflict $ damage to its target. Your Pet's happiness increases the damage done. The pet must be in combat and within 5 yards of the target to Kill Command.
kill_shot 952 3.4% 16.4 5.42sec 26281 26124 19057 39357 50516 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.37 16.22 0.00 0.00 1.0060 0.0000 430252
Direct Results Count Pct Average Min Max Total Damage
hit 10.3 63.23% 19057.42 17624 24522 195466
crit 6.0 36.77% 39357.22 36305 50516 234786

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 4303 15.4% 237.7 1.91sec 8183 4309 5905 12228 16284 36.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
237.73 237.73 0.00 0.00 1.8990 0.0000 1945398
Direct Results Count Pct Average Min Max Total Damage
hit 152.1 63.96% 5904.77 5607 7905 897861
crit 85.7 36.04% 12227.64 11551 16284 1047537

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1182 4.2% 1.0 0.00sec 534432 515355 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2908 4506 41.0% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 149.97 149.97 1.0370 3.0000 534432
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 88.5 58.98% 2908.26 2793 3927 257262
crit 61.5 41.02% 4505.87 4315 6067 277170

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - cat 11402
call_of_the_wild 0 0.0% 2.7 210.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.67 2.67 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:210.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 3694 32.4% 151.3 3.00sec 11039 7182 6633 13528 21379 63.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.25 151.25 0.00 0.00 1.5370 0.0000 1669731
Direct Results Count Pct Average Min Max Total Damage
hit 54.6 36.09% 6632.61 2856 10689 362069
crit 96.7 63.91% 13527.80 5712 21379 1307662

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
kill_command 4813 42.2% 68.0 6.68sec 31984 0 19711 39678 65182 61.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.03 68.03 0.00 0.00 0.0000 0.0000 2175767
Direct Results Count Pct Average Min Max Total Damage
hit 26.2 38.53% 19710.77 17460 32591 516668
crit 41.8 61.47% 39678.07 34919 65182 1659099

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.19
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:926.00
  • base_dd_max:926.00
melee 2895 25.4% 418.2 1.08sec 3129 2896 2137 4309 6505 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.22 418.22 0.00 0.00 1.0805 0.0000 1308714
Direct Results Count Pct Average Min Max Total Damage
hit 102.6 24.53% 2136.70 1910 3252 219227
crit 215.3 51.48% 4309.44 3819 6505 927825
glance 100.3 23.99% 1611.43 1432 2439 161663

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.3 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_BM_T11_372
arcane_shot focus 54.8% 901.4 18
kill_command focus 44.9% 1009.3 32
serpent_sting focus 0.3% 42754.6 12
pet - cat
claw focus 100.0% 336.1 33
Resource Gains Type Count focus Average Overflow
cobra_shot focus 178.5 1605.0 9.0 0.1%
fervor focus 1.7 85.6 50.0 0.0%
focus_regen focus 1809.3 2499.2 1.4 0.3%
invigoration focus 96.7 575.3 6.0 0.8%
pet - cat focus
fervor focus 1.7 35.2 20.6 58.9%
focus_fire focus 25.6 85.4 3.3 16.8%
focus_regen focus 1809.3 4074.3 2.3 14.0%
go_for_the_throat focus 85.7 723.5 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 6.9 0.0 70.6sec 70.6sec 15% 12%

Database details

  • id:34471
  • cooldown name:buff_beast_within
  • tooltip:Enraged.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_ap 4.3 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cobra_strikes 18.0 3.9 24.4sec 19.8sec 19% 26%

Database details

  • id:53257
  • cooldown name:buff_cobra_strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
culling_the_herd 6.5 90.1 69.2sec 4.7sec 94% 94%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.2 0.0 57.5sec 57.5sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
focus_fire 25.6 0.0 17.5sec 17.5sec 84% 84%

Database details

  • id:82692
  • cooldown name:buff_focus_fire
  • tooltip:Ranged haste increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
killing_streak 15.8 0.0 27.9sec 27.9sec 23% 22%

Database details

  • id:
  • cooldown name:buff_killing_streak
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.4sec 55.4sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bestial_wrath 6.9 0.0 70.6sec 70.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_bestial_wrath
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 6.5 90.1 69.2sec 4.7sec 94% 93%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-frenzy 26.5 124.7 17.3sec 3.0sec 89% 92%

Database details

  • id:
  • cooldown name:buff_frenzy
  • tooltip:(null)
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 14.3 0.0 32.9sec 32.9sec 62% 62%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 14.3 381.7 32.9sec 1.1sec 98% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 47.0 6.1 9.6sec 8.4sec 18% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 69.85%
σ of the average dps 4.1792
2 * σ / μ 0.0299%
95% Confidence Intervall ( μ ± 2σ ) ( 27990.47 - 28007.18 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27986.29 - 28011.36 )
Sample Data
σ 417.9171
Minimum 26506.39
Maximum 29783.30
Spread ( max - min ) 3276.91
Range ( max - min ) / 2 1638.46
Range% 5.85
10th Percentile 27484.27
90th Percentile 28543.87
( 90th Percentile - 10th Percentile ) 1059.59
Approx. Iterations needed for
1% dps error 8
0.1% dps error 891
0.1 scale factor error with delta=300 1552
0.05 scale factor error with delta=300 6209
0.01 scale factor error with delta=300 155248
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B bestial_wrath,if=focus>60
C multi_shot,if=target.adds>5
D cobra_shot,if=target.adds>5
E serpent_sting,if=!ticking
F kill_shot
G rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
H kill_command
I fervor,if=focus<=20
J focus_fire,five_stacks=1,if=!buff.beast_within.up
K arcane_shot,if=focus>=90|buff.beast_within.up
L cobra_shot

Sample Sequence

0134579BEHKKKKKHKKLLJKHLLKLKHLLKLKHLJLKLKHLLKLKHLLGKLJKHLKLKLHLKLKLHLJLKKLHLLKLLHBKKKKKHKKKKJLHLLLLKHLLLKLHJLKLKLHLLKKLHLJKLKLHLLKL9KHLLJKLKHLLKLLHLKLBKKHKKKKKHKJLLLKHLLLKLHLLKJLKHLLKLKHLLLKKHJLLLKLHLLKKLHLJLKLKHLLLKLHBKKKKKHKKKKJLHILLKLHLKLKLHJLKL9KLHLKLKLHLJKLKLHLKLKLHLKLJKLHLLKKLHLLKLBKHKKKKKHKKJLLLHLKLKLHLLKJLKHLLLKLHLLKKJLHLLKKLHLLKLKHJLLGKLKHLKLKLHLKBKKKHKKKK9KHJLLLLHLKLKLHLLJKLKHLLLKLHLLKJLKHLLKLKHLLLKJLHLLKLKHLLKLKBHKKKKKHKKKIJLHLFFKLHLLKLKFFHJLLKLKHLFFLKHLLJLKLFFHLKLKLH9LFFJKKH4LLKLKBHFFKKKHKKKJLLFFHLKLKLHLFFJKLHLKLKLFFHLKLJKLHLFFKLHL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 8466 5817 5345
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 26125 14968 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.39% 29.23% 2305
Melee Haste 13.46% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.11% 6.87% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 2
One with Nature 3
Bestial Discipline 3
Pathfinding 0
Spirit Bond 2
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 3
Fervor 1
Focus Fire 1
Longevity 3
Killing Streak 2
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 1
Ferocious Inspiration 1
Kindred Spirits 2
The Beast Within 1
Invigoration 2
Beast Mastery 1
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 0
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_BM_T11_372
origin="http://chardev.org/?profile=34113"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
glyphs=bestial_wrath/kill_command/arcane_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/bestial_wrath,if=focus>60
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking
actions+=/kill_shot
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/fervor,if=focus<=20
actions+=/focus_fire,five_stacks=1,if=!buff.beast_within.up
actions+=/arcane_shot,if=focus>=90|buff.beast_within.up
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010122000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372 : 31653dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31652.8 15.81 / 0.05% 2790.0 11.3 11.2 focus 0.00% 59.9
Origin http://chardev.org/?profile=34117
Talents http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
Glyphs
  • steady_shot
  • aimed_shot
  • rapid_fire

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:35895|22368|20339|7407|4497|3323|1582&chds=0,71790&chco=336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++35895++chimera_shot,336600,0,0,15|t++22368++aimed_shot,C79C6E,1,0,15|t++20339++kill_shot,C79C6E,2,0,15|t++7407++steady_shot,C79C6E,3,0,15|t++4497++ranged,C79C6E,4,0,15|t++3323++claw,C79C6E,5,0,15|t++1582++melee,C79C6E,6,0,15&chtt=Hunter_MM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,18,13,9,8,7,7,5,5,3,1&chds=0,100&chco=C79C6E,C55D54,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=aimed_shot|piercing_shots|steady_shot|chimera_shot|ranged|aimed_shot_mm|wild_quiver_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7pYjxighjfsurillehiiffggacfjfcfhddghfefhgfklhkmjlljklkkihdddcbaabcbbbbbbaabbbaaabaaaabbbabbbbbccdddeeeeeddeeeeeeeeeeeeeeeeeeeeeddddeeedddddddddddddddddddddddddddeeeeeeeeeeeeefffeeeeeffffffffeeeeeeedcddddddddddddddddddddddZVXdhjkkiihcXXadgijjiheaZbehijhghhfcaaabdfhigdbaabceghhfcbabcdfhihfcbbbcefhihfcbbcdegiihecbccdfhiihedccdegijjhedcdefhjjigedddeghjjhfedddfghjjhffeefgikljhfeedefhjjhffeeefgijjhgfeefghjkjigfffghikkjhdZaejorpmkifbbeimoonlifccfknonljhf&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:00z004244434685443100zyzyxvvttsrsrrrrrrssssssssssssstssrrqqppoonmllkjjihhgggfffeeeeddddcccccbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbbaaaaaaZZZZZYYYYYYYYYYYZZaaabbccdefgghhhijjjkkllmmllllkjjjiiihggfeedccbbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZZZZZaaaaaaaaaaaabbbbbcccccddeeffffffffgghhhhhhhgggfgggghhhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31653|max=62274&chxp=1,1,51,100&chtt=Hunter_MM_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,3,4,15,14,26,32,45,62,105,129,172,186,252,265,360,399,435,529,568,583,549,570,573,591,553,520,420,358,346,263,272,183,151,131,83,69,68,31,15,29,8,7,7,8,3,1,2,2&chds=0,591&chbh=5&chxt=x&chxl=0:|min=28926|avg=31653|max=34767&chxp=0,1,47,100&chtt=Hunter_MM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372 31653
aimed_shot 7635 24.1% 77.2 5.87sec 44742 22368 27698 59057 70452 54.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.16 76.99 0.00 0.00 2.0003 0.0000 3452168
Direct Results Count Pct Average Min Max Total Damage
hit 34.9 45.35% 27697.99 26825 34200 967039
crit 42.1 54.65% 59056.53 55260 70452 2485128

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2162 6.8% 23.4 18.82sec 41731 0 28033 58353 71552 45.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.42 23.37 0.00 0.00 0.0000 0.0000 977322
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 54.56% 28032.84 27244 34734 357469
crit 10.6 45.44% 58353.40 56123 71552 619853

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
chimera_shot 2883 9.1% 35.9 10.59sec 36348 35895 26236 54143 61279 36.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.86 35.77 0.00 0.00 1.0126 0.0000 1303557
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.42% 26236.16 25522 29747 595083
crit 13.1 36.58% 54143.13 52576 61279 708474

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 397 1.3% 8.7 10.62sec 20566 20339 15056 31011 34397 35.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.73 8.63 0.00 0.00 1.0112 0.0000 179523
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 64.06% 15055.99 14794 16697 83273
crit 3.1 35.94% 31011.31 30476 34397 96250

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 5743 18.1% 160.9 2.80sec 16141 0 0 0 0 0.0% 0.0% 0.0% 0.0% 363 7160 0 0.0% 0.0% 80.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.88 160.88 362.66 362.66 0.0000 1.0000 2596657
Direct Results Count Pct Average Min Max Total Damage
hit 160.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 362.7 100.00% 7159.95 816 35144 2596657

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3409.76
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 2594 8.2% 146.7 3.09sec 7997 4497 5732 11862 13905 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.67 146.67 0.00 0.00 1.7782 0.0000 1172876
Direct Results Count Pct Average Min Max Total Damage
hit 92.5 63.06% 5732.28 5550 6750 530223
crit 54.2 36.94% 11862.37 11432 13905 642652

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 818 2.6% 1.4 105.52sec 260981 258651 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2418 3743 40.7% 0.0% 82.9%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.42 1.42 125.00 125.00 1.0090 3.0000 369679
Direct Results Count Pct Average Min Max Total Damage
hit 1.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 74.1 59.28% 2418.29 2353 2717 179209
crit 50.9 40.72% 3742.54 3635 4198 190470

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4068 12.9% 208.1 2.16sec 8841 7407 5919 12353 14446 45.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.06 207.68 0.00 0.00 1.1937 0.0000 1839506
Direct Results Count Pct Average Min Max Total Damage
hit 112.8 54.33% 5919.13 5786 7013 667857
crit 94.8 45.67% 12353.00 11919 14446 1171648

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2064 6.5% 121.8 3.70sec 7661 0 5586 11216 13159 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.79 121.79 0.00 0.00 0.0000 0.0000 933078
Direct Results Count Pct Average Min Max Total Damage
hit 76.9 63.15% 5586.18 5420 6580 429620
crit 44.9 36.85% 11216.10 10840 13159 503458

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3290
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1709 51.9% 151.3 3.00sec 5108 3323 3355 6774 10441 51.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.25 151.25 0.00 0.00 1.5370 0.0000 772560
Direct Results Count Pct Average Min Max Total Damage
hit 73.7 48.75% 3355.43 1767 5220 247410
crit 77.5 51.25% 6774.42 3535 10441 525151

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1581 48.1% 384.4 1.17sec 1859 1582 1275 2565 3174 51.1% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
384.44 384.44 0.00 0.00 1.1753 0.0000 714742
Direct Results Count Pct Average Min Max Total Damage
hit 95.5 24.85% 1274.90 1181 1587 121810
crit 196.6 51.14% 2565.11 2361 3174 504329
glance 92.3 24.00% 960.11 885 1190 88604

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372
aimed_shot focus 68.5% 981.8 46
chimera_shot focus 30.8% 826.1 44
serpent_sting focus 0.7% 10439.2 25
pet - cat
claw focus 100.0% 184.5 28
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.3 2352.6 1.3 2.8%
glyph_aimed_shot focus 52.8 261.1 4.9 1.0%
rapid_recuperation focus 312.3 339.1 1.1 6.0%
steady_shot focus 208.1 2132.1 10.2 0.2%
pet - cat focus
focus_regen focus 1809.3 3660.7 2.0 13.5%
go_for_the_throat focus 54.2 468.5 8.6 13.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.8 67.7 46.9sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.8sec 55.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.1 68.4 42.9sec 5.7sec 95% 95%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.2 95.0 18.7sec 3.8sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.5 0.0 18.8sec 18.8sec 5% 5%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 18%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.6sec 222.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 57.7sec 57.7sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.8 67.7 46.9sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 237.3 45.0sec 1.8sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.3 6.5 9.7sec 8.5sec 16% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 121.8 3.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.93%
σ of the average dps 7.9042
2 * σ / μ 0.0499%
95% Confidence Intervall ( μ ± 2σ ) ( 31637.03 - 31668.64 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31629.12 - 31676.55 )
Sample Data
σ 790.4178
Minimum 28926.47
Maximum 34767.43
Spread ( max - min ) 5840.96
Range ( max - min ) / 2 2920.48
Range% 9.23
10th Percentile 30654.57
90th Percentile 32696.38
( 90th Percentile - 10th Percentile ) 2041.82
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2494
0.1 scale factor error with delta=300 5553
0.05 scale factor error with delta=300 22213
0.01 scale factor error with delta=300 555342
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
M steady_shot

Sample Sequence

0134568AGHL6L6MIL6ML6ML6MIKL6L6MML6MMML6KL6L6MIML6MML6MMML6GMMLL6L6MML6ML6MILL6ML6MIL6MML6MMML6MML6MMMLL6MIL6MML6MEMIFKMMMMML6FKL6MIMMMFL6MIMKMMFL6MMMMMLFL6MIMMML6FKL6MIMML6FMMML6MMMFKML6MAIMMMFLL6MIMML6MFMIML6MMMFKML6MIMMFMMGH5FML6KL6L6MIL6MFMMGL6MML6KL6FMIL6MML6MMMFKML6MIMMMFL6MIMKML6MFMIMMMKL6FMIML6MMMFLML6MIMMFMML6MMMMFKL6MIMMMFML6MIMML6FKL6MIMML6FMMMMMLL6AFMIML6MMMMFMML6MMMKFMML6MMMMFML6KMIL6MFMIL6MMMLFGHFMIL6L6MML6ML6MFMIGL6KL6L6MIFJL6MML6MML6JFMIL6MMMJFKMIL6MMJFL6MIMML6FJKL6MIML6FJMIL6MMML6JFMIML6KL6JFMIL6MMMJFL6MIMKL6JFMIL6AMMM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8471 5822 5345
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.43% 12.43% 2229
Spell Haste 16.28% 10.75% 1376
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20914 11984 190
Melee Hit 8.04% 8.04% 966
Melee Crit 41.98% 28.82% 2229
Melee Haste 14.07% 10.75% 1376
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.12% 6.89% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 2
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 2
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372
origin="http://chardev.org/?profile=34117"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
glyphs=steady_shot/aimed_shot/rapid_fire
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2229
# gear_haste_rating=1376
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372_Arcane : 31040dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31039.9 13.64 / 0.04% 2911.7 10.7 10.5 focus 0.00% 59.1
Origin http://chardev.org/?profile=34115
Talents http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
Glyphs
  • steady_shot
  • rapid_fire
  • arcane_shot

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:36113|24692|20471|13048|7373|4314|3610|1689&chds=0,72227&chco=336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++36113++chimera_shot,336600,0,0,15|t++24692++aimed_shot,C79C6E,1,0,15|t++20471++kill_shot,C79C6E,2,0,15|t++13048++arcane_shot,69CCF0,3,0,15|t++7373++steady_shot,C79C6E,4,0,15|t++4314++ranged,C79C6E,5,0,15|t++3610++claw,C79C6E,6,0,15|t++1689++melee,C79C6E,7,0,15&chtt=Hunter_MM_T11_372_Arcane+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:15,14,14,11,9,8,7,6,6,5,3,1&chds=0,100&chco=C55D54,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,C79C6E&chl=piercing_shots|aimed_shot|steady_shot|ranged|chimera_shot|wild_quiver_shot|aimed_shot_mm|arcane_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372_Arcane+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7nSdranVjYfsjogeggffdcfcZageYZegcbcdfcabhhgjlhijhhjihjicccccaYYYZYXWXYYXWVVWWWVUVVVUUUUUUUUUUUUUUUUUUVVUUTTUUUUUUUUTTTUUUUUUUUTTTUUUUUVUUTTUUUUUVUUTTTUUUUUVUUTUUUUVVVVVVUVVVVVVVVUVZccaWVWXXXTRSUUUTRQQRSTVWWVTRRRSUVWXWUSRUURUbhihjihheYWXaeiiijhecaZbehhdabbYUQOOPSWZbaWSPNOQUYbbZUQONPSWacaXTPNOQUYbcZVROOPSWZcbXTQOOQUYbcaWSPPQTXadcZVRPPRVYbcaXTQPQSWZccZVRPPRUYbcddaZYWWZccYVUVUSQPQSUWYYXUTRSTVYZaZXUTSTVXZaaYWUTTUWYaaaaXWYcinpnkigcZZbfjlmljhebacfilliebZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372_Arcane+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz1y2033444578544321110z0xyvutsrsrrrrrrrrrrrrrrrrrrrrrrqqqpponnmmlkjjiihhgggfffeeeeddddcccccbbbbbaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZYYYYYYYYYYYZaaaabbbcddegghhhiijjjkllmllllllkjjjiiihgffeddccbbaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZYYZZZZZZZZZZZZaaaaaaaaaaaaaaaaZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaabbbbbccdddeeeeeeffggggghhhggffgggghhhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31040|max=61436&chxp=1,1,51,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,1,0,0,7,7,12,14,28,48,73,90,133,166,251,303,380,474,532,610,590,696,644,691,677,610,547,484,423,355,279,216,166,149,93,79,60,37,30,16,12,2,5,3,0,3,2,1&chds=0,696&chbh=5&chxt=x&chxl=0:|min=28167|avg=31040|max=33958&chxp=0,1,50,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372_Arcane 31040
aimed_shot 4199 13.5% 37.1 11.48sec 51174 24692 28312 60345 70327 71.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.10 37.05 0.00 0.00 2.0725 0.0000 1898631
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 28.40% 28312.34 26771 34139 297874
crit 26.5 71.60% 60345.35 55149 70327 1600757

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2190 7.1% 23.6 18.73sec 41949 0 27984 58336 71426 46.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.61 23.56 0.00 0.00 0.0000 0.0000 990196
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 53.71% 27984.26 27189 34673 354110
crit 10.9 46.29% 58335.66 56010 71426 636086

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
arcane_shot 1983 6.4% 68.4 5.41sec 13114 13048 9470 19503 21283 36.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.39 68.22 0.00 0.00 1.0051 0.0000 896798
Direct Results Count Pct Average Min Max Total Damage
hit 43.2 63.36% 9469.69 9291 10332 409348
crit 25.0 36.64% 19502.77 19140 21283 487450

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
chimera_shot 2889 9.3% 36.0 10.55sec 36338 36113 26186 54031 61176 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.95 35.85 0.00 0.00 1.0062 0.0000 1306437
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.18% 26186.40 25473 29697 593159
crit 13.2 36.82% 54030.89 52474 61176 713278

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 404 1.3% 8.9 10.50sec 20618 20471 15034 30969 34332 36.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.85 8.74 0.00 0.00 1.0072 0.0000 182469
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.38% 15033.55 14766 16666 83308
crit 3.2 36.62% 30969.43 30419 34332 99161

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 4773 15.4% 149.9 3.00sec 14393 0 0 0 0 0.0% 0.0% 0.0% 0.0% 358 6030 0 0.0% 0.0% 79.1%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
149.93 149.93 357.86 357.86 0.0000 1.0000 2157973
Direct Results Count Pct Average Min Max Total Damage
hit 149.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 357.9 100.00% 6030.20 815 33606 2157973

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1208.25
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 3547 11.4% 201.4 2.25sec 7963 4314 5704 11793 13885 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
201.42 201.42 0.00 0.00 1.8458 0.0000 1603960
Direct Results Count Pct Average Min Max Total Damage
hit 126.7 62.90% 5704.16 5541 6740 722639
crit 74.7 37.10% 11792.91 11414 13885 881321

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 816 2.6% 1.7 125.31sec 211782 210336 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2414 3735 41.1% 0.0% 82.8%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.74 1.74 124.81 124.81 1.0069 3.0000 369114
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.5 58.89% 2414.16 2349 2713 177457
crit 51.3 41.11% 3735.45 3629 4191 191657

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4192 13.5% 213.2 2.11sec 8890 7373 5913 12342 14426 46.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
213.19 212.80 0.00 0.00 1.2058 0.0000 1895229
Direct Results Count Pct Average Min Max Total Damage
hit 113.7 53.44% 5912.80 5777 7003 672408
crit 99.1 46.56% 12342.29 11901 14426 1222821

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2503 8.1% 148.0 3.04sec 7645 0 5570 11178 13141 37.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
148.01 148.01 0.00 0.00 0.0000 0.0000 1131547
Direct Results Count Pct Average Min Max Total Damage
hit 93.2 63.00% 5570.40 5412 6570 519391
crit 54.8 37.00% 11178.03 10823 13141 612156

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3545
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1857 52.4% 151.3 3.00sec 5549 3610 3641 7336 10421 51.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.25 151.25 0.00 0.00 1.5370 0.0000 839246
Direct Results Count Pct Average Min Max Total Damage
hit 73.2 48.37% 3640.76 1764 5211 266375
crit 78.1 51.63% 7336.09 3527 10421 572871

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1688 47.6% 410.0 1.10sec 1861 1689 1273 2561 3168 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
410.02 410.02 0.00 0.00 1.1021 0.0000 763184
Direct Results Count Pct Average Min Max Total Damage
hit 100.2 24.43% 1272.83 1178 1584 127519
crit 211.4 51.55% 2560.88 2356 3168 541262
glance 98.5 24.02% 958.67 884 1188 94404

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372_Arcane
aimed_shot focus 35.1% 1123.3 46
arcane_shot focus 31.2% 596.1 22
chimera_shot focus 32.8% 825.9 44
serpent_sting focus 0.9% 8471.3 25
pet - cat
claw focus 100.0% 202.0 27
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.3 2356.2 1.3 1.2%
rapid_recuperation focus 312.6 345.6 1.1 3.8%
steady_shot focus 213.2 2058.5 9.7 0.0%
pet - cat focus
focus_regen focus 1809.3 3473.7 1.9 16.7%
go_for_the_throat focus 74.7 630.7 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.7 68.4 47.4sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.0sec 55.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.5 68.8 41.0sec 5.6sec 96% 97%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.4 95.8 18.6sec 3.7sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.7 0.0 18.7sec 18.7sec 7% 7%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.1 0.0 80.1sec 80.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 17%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.2sec 222.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.0sec 55.0sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.7 68.4 47.4sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 248.7 45.0sec 1.7sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 55.9 6.7 8.1sec 7.2sec 20% 37%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 148.0 3.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.27%
σ of the average dps 6.8190
2 * σ / μ 0.0439%
95% Confidence Intervall ( μ ± 2σ ) ( 31026.25 - 31053.52 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31019.43 - 31060.34 )
Sample Data
σ 681.8968
Minimum 28167.08
Maximum 33957.58
Spread ( max - min ) 5790.50
Range ( max - min ) / 2 2895.25
Range% 9.33
10th Percentile 30202.31
90th Percentile 31934.73
( 90th Percentile - 10th Percentile ) 1732.42
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1930
0.1 scale factor error with delta=300 4133
0.05 scale factor error with delta=300 16532
0.01 scale factor error with delta=300 413318
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
M arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
N steady_shot

Sample Sequence

0134568AGHL6L6NIL6NL6NL6NILL6L6NNNL6NNL6NNNL6NNNLL6NNL6NNNGL6LL6L6NIL6NNL6NNL6NNLL6NNL6NNNL6NNNLL6NIL6NNNL6NNLL6NENINFNMNINKNMFNIMMNNNNFKMNMNINNFMNMNINNKFMMNINNNMFNMNIKNMNFMNIMNNNMNFMKNINAL6NNFNNNL6NNNNFKMNMNINNFMNMNINNMFKMNGH5IFNNL6NNL6NL6NIFGKNL6NIL6NL6NFNIL6NNNMNFKMNINNMNFMNIMKNNNFMMNINNNMFKMNINNMNFMNIMNNNMFNMNINNMKFNMNINNMNMFNIMMNNNNFKMNMNINNFMNMNINNAKFNL6NINL6NNFNKMNINNMFNMNINKNMFNIMMNNNNMFKMNINNMNMFGHNFLNIL6NL6NL6NIFGNL6NNL6JNL6NFNILL6NJMNFMNINNJKMFMNIMNNJMFNMNINKMJMFNIMMNNNJFMNIMKNNJFMNMNINMJFMNIMNNNJFKMMNINNJFMMNIANL6NJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8449 5801 5325
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20860 11942 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.34% 29.18% 2305
Melee Haste 12.35% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.08% 6.84% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.96% 11.96% 710

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 1
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 1
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 2
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372_Arcane
origin="http://chardev.org/?profile=34115"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
glyphs=steady_shot/rapid_fire/arcane_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5325
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=710
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_SV_T11_372 : 26517dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26516.8 7.43 / 0.03% 2621.5 10.1 10.0 focus 0.00% 51.1
Origin http://chardev.org/?profile=34116
Talents http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
Glyphs
  • arcane_shot
  • explosive_shot
  • kill_shot

Charts

http://8.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:34052|31833|28209|17481|11640|3997|3850|1429|901&chds=0,68104&chco=C41F3B,9482C9,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++34052++explosive_shot,C41F3B,0,0,15|t++31833++black_arrow,9482C9,1,0,15|t++28209++kill_shot,C79C6E,2,0,15|t++17481++arcane_shot,69CCF0,3,0,15|t++11640++cobra_shot,336600,4,0,15|t++3997++claw,C79C6E,5,0,15|t++3850++ranged,C79C6E,6,0,15|t++1429++melee,C79C6E,7,0,15|t++901++wolverine_bite,C79C6E,8,0,15&chtt=Hunter_SV_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:28,23,14,7,7,6,5,5,4,1,0&chds=0,100&chco=336600,C41F3B,C79C6E,C79C6E,69CCF0,336600,C79C6E,9482C9,C79C6E,C79C6E,336600&chl=cobra_shot|explosive_shot|ranged|claw|arcane_shot|serpent_sting|melee|black_arrow|kill_shot|wolverine_bite|serpent_sting_burst&chtt=Hunter_SV_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yuXYn04mmz677ut1313tpuwwyxiYYZgqnmsvvyyqswuwysuzzyzsjgggilnorsrsttuuttttstsplfbZabdhknqstuvwwwvuuuutrmieccdfhjmoqrstuuuuttsssqmhecbbdfhkmoqsttuuutttsrpmifdccdfhkmoqstuvvvuuutsqnkigffghjlnpqsttuuuttttrpnkhfedefgilnoqrsttttttssrponlmmnpqsstttuuuttuuttsqomkiggghjkmoprstuuuutttsqomjigfffgikmnpqsstttttsrqonlllllmnpstttuvvvutttssrpnkihggghijlnpqrssttuttsrqomjhgggghiklmoprrssstssrpnlkihgffghjkmnoprrssssrrqomlkjjkloqrtuvwwwvvvuutsqpnljihggghijlmopqrrsssrrq&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Hunter_SV_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:22333464444468765422zyxxwwvtuutstsrrrqrrrrrqpoonnnmmmmmmmnnnmnnnononnmmmlllklkkkkkkkkkklllllllkkjjjjjjjijijjjjjjjjkkklkkkkkjkjjjjjjjjjjjjjjjkjjjjjiiiiihihiiiiiijjjjkkkkkkkkkkkkkjkjjkjjjkkkkkkkkkjjjjjiiiiiiiiiiiiiiijjjjjjjjjijijjjjjjjjkjkkkllllllllllklkkkkkkkkkkkkkkkkkkkkkjjjjjjjjjjjjjjjjjjkkkklklllmmmmnnoopooppppppppooonnnmmllllllllmmmmmmnnnnnnnnnmmmmmmmmmmmnnnnnnooonoonnnnnnnmmmmmmmmmmmnnnnnnnnnnnnnnnnnoooooopppppppppppppooooooooooooopppppppqpqqpq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26517|max=40866&chxp=1,1,65,100&chtt=Hunter_SV_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,1,1,6,4,9,19,31,37,54,82,102,156,184,242,317,367,479,550,575,617,648,686,635,560,596,479,453,423,350,317,253,195,136,112,85,74,55,36,18,22,11,9,5,4,2,2&chds=0,686&chbh=5&chxt=x&chxl=0:|min=24987|avg=26517|max=27956&chxp=0,1,52,100&chtt=Hunter_SV_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_SV_T11_372 26517
arcane_shot 1782 6.7% 45.8 9.72sec 17576 17481 12472 25807 29416 38.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.85 45.79 0.00 0.00 1.0054 0.0000 805790
Direct Results Count Pct Average Min Max Total Damage
hit 28.2 61.55% 12472.07 12080 14280 351499
crit 17.6 38.45% 25807.31 24885 29416 454291

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 1299 4.9% 18.4 25.23sec 32003 31833 0 0 0 0.0% 0.0% 0.0% 0.0% 90 4611 9673 38.2% 0.0% 59.6%

Stats details: black_arrow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.35 18.31 89.76 89.76 1.0054 3.0000 587308
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 55.5 61.84% 4610.89 4458 5425 255936
crit 34.3 38.16% 9672.90 9317 11339 331372

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $o1 Shadow damage over $d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.095000
  • base_td:407.33
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
cobra_shot 7471 28.2% 210.3 2.14sec 16063 11640 10636 22110 25195 47.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.29 209.92 0.00 0.00 1.3800 0.0000 3377870
Direct Results Count Pct Average Min Max Total Damage
hit 110.1 52.46% 10636.43 10408 12231 1171384
crit 99.8 47.54% 22110.37 21440 25195 2206486

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
explosive_shot 6124 23.1% 80.8 5.61sec 34255 34052 0 0 0 0.0% 0.0% 0.0% 0.0% 240 7776 16320 44.2% 0.0% 35.2%

Stats details: explosive_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.83 80.66 239.60 239.60 1.0060 0.6634 2768815
Direct Results Count Pct Average Min Max Total Damage
hit 80.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.6 55.76% 7776.28 7501 9310 1038928
crit 106.0 44.24% 16319.51 15678 19458 1729887

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:Taking $w1 Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing $ Fire damage. The charge will blast the target every second for an additional $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.232000
  • base_td:353.32
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
kill_shot 948 3.6% 15.1 5.87sec 28370 28209 18199 37643 43151 54.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.12 14.93 0.00 0.00 1.0057 0.0000 428816
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 45.91% 18198.78 17321 20947 124760
crit 8.1 54.09% 37643.31 35682 43151 304056

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 3843 14.5% 207.3 2.19sec 8380 3850 5941 12291 14027 38.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.34 207.34 0.00 0.00 2.1764 0.0000 1737544
Direct Results Count Pct Average Min Max Total Damage
hit 127.7 61.60% 5941.38 5765 6809 758817
crit 79.6 38.40% 12291.30 11876 14027 978727

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1678 6.3% 1.0 0.00sec 758537 731515 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3137 6577 53.1% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 149.97 149.97 1.0369 3.0000 744586
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 70.3 46.87% 3137.19 3047 3676 220528
crit 79.7 53.13% 6577.12 6369 7682 524058

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
serpent_sting_burst 15 0.1% 1.0 0.00sec 6975 0 4834 9959 9959 41.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 6975
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 58.22% 4834.42 4834 4834 2815
crit 0.4 41.78% 9958.90 9959 9959 4161

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3903.54
  • base_dd_max:3903.54
pet - wind_serpent 3389
claw 1826 53.9% 134.3 3.36sec 6143 3997 4233 8520 12431 44.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.33 134.33 0.00 0.00 1.5370 0.0000 825247
Direct Results Count Pct Average Min Max Total Damage
hit 74.5 55.44% 4233.02 1978 6215 315220
crit 59.9 44.56% 8519.76 3955 12431 510026

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
lightning_breath 0 0.0% 15.5 30.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_breath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.46 15.46 0.00 0.00 1.4623 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.5 100.00% 0.00 0 0 0

Action details: lightning_breath

Static Values
  • id:24844
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases magic damage taken by $s2%.
  • description:Breathes lightning, increasing magic damage taken by $s2% for $d.
melee 1428 42.1% 321.9 1.40sec 2005 1429 1442 2899 3779 44.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
321.93 321.93 0.00 0.00 1.4032 0.0000 645463
Direct Results Count Pct Average Min Max Total Damage
hit 101.2 31.45% 1441.68 1321 1889 145966
crit 143.4 44.54% 2898.89 2643 3779 415637
glance 77.3 24.01% 1084.83 991 1417 83859

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
roar_of_recovery 0 0.0% 2.7 181.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_recovery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: roar_of_recovery

Static Values
  • id:53517
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1 focus every $t1 sec.
  • description:Your pet's inspiring roar restores $o1 focus over $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
wolverine_bite 135 4.0% 45.1 10.09sec 1351 901 933 1873 2471 44.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolverine_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.11 45.11 0.00 0.00 1.4992 0.0000 60927
Direct Results Count Pct Average Min Max Total Damage
hit 25.1 55.54% 932.66 851 1236 23368
crit 20.1 44.46% 1872.82 1701 2471 37559

Action details: wolverine_bite

Static Values
  • id:53508
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A fierce attack causing $ damage, that your pet can use after it makes a critical attack. Cannot be dodged, blocked or parried.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1.00
  • base_dd_max:1.00

Resources

Resource Usage Type Res% DPR RPE
Hunter_SV_T11_372
arcane_shot focus 22.1% 798.9 22
black_arrow focus 14.0% 914.4 35
explosive_shot focus 63.4% 955.6 36
serpent_sting focus 0.5% 30341.5 25
pet - wind_serpent
claw focus 100.0% 222.2 28
Resource Gains Type Count focus Average Overflow
cobra_shot focus 210.3 1887.3 9.0 0.3%
focus_regen focus 1809.3 2244.5 1.2 0.6%
roar_of_recovery focus 8.2 80.9 9.9 0.7%
thrill_of_the_hunt focus 21.7 305.9 14.1 2.1%
pet - wind_serpent focus
focus_regen focus 1809.3 3019.1 1.7 15.9%
go_for_the_throat focus 79.6 650.5 8.2 18.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
culling_the_herd 18.2 41.6 24.9sec 7.5sec 82% 81%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.6sec 57.6sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
lock_and_load 7.5 0.0 56.6sec 56.6sec 5% 12%

Database details

  • id:56453
  • cooldown name:buff_lock_and_load
  • tooltip:Your next Arcane Shot or Explosive Shot spells trigger no cooldown and cost no focus.
  • max_stacks:2
  • duration:12.00
  • cooldown:22.00
  • default_chance:12.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 58.3sec 58.3sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
wind_serpent-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 6%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-culling_the_herd 18.2 41.6 24.9sec 7.5sec 82% 78%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-owls_focus 40.3 0.0 11.0sec 11.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_owls_focus
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:30.00%
wind_serpent-sic_em 17.1 0.5 25.3sec 24.5sec 7% 13%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-wolverine_bite 46.1 177.2 9.9sec 2.0sec 89% 100%

Database details

  • id:
  • cooldown name:buff_wolverine_bite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sniper_training

Database details

  • id:64420
  • cooldown name:buff_sniper_training
  • tooltip:Damage done by your Steady Shot and Cobra Shot increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:300.00%

Uptimes

%

Procs

Count Interval
lock_and_load 7.5 56.6sec
thrill_of_the_hunt 21.7 19.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.99%
σ of the average dps 3.7148
2 * σ / μ 0.0280%
95% Confidence Intervall ( μ ± 2σ ) ( 26509.33 - 26524.19 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26505.62 - 26527.91 )
Sample Data
σ 371.4780
Minimum 24987.35
Maximum 27956.29
Spread ( max - min ) 2968.94
Range ( max - min ) / 2 1484.47
Range% 5.60
10th Percentile 26068.43
90th Percentile 27011.09
( 90th Percentile - 10th Percentile ) 942.66
Approx. Iterations needed for
1% dps error 7
0.1% dps error 785
0.1 scale factor error with delta=300 1226
0.05 scale factor error with delta=300 4906
0.01 scale factor error with delta=300 122663
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B multi_shot,if=target.adds>2
C cobra_shot,if=target.adds>2
D serpent_sting,if=!ticking
E rapid_fire
F explosive_shot,non_consecutive=1
G black_arrow,if=!ticking
H kill_shot
I arcane_shot,if=focus>=70&buff.lock_and_load.down
J cobra_shot

Sample Sequence

0134579DEFGJJJIFJJIJIIFJJJIJFJJIJIFJJGJJFJJJJIFJJJIFJJIIJFJGJJFJJJJFJFJFIFJJJJFGJJJFJJJIJFJJIJIFJJJGJFJJJJFJJJ9IFJJIJFJGJJFJJJIFJJJIFJJJJFGJJIFJFIFJJJIFJJJJFJGJJJFJFIFJJIJFJJJIFJGJJJFJFIFJJJIFJJJIFJGJJFJJFJFI9FJJIJFJJJGFJJJJFJJJFJFIFJJIJIFJGJJJFJJJJFJIJIJFJEJJIGFJJFJFIFJJIIJFJJJIFJJGJJFJJFJFIFJJIJFJJIJGFJJJJ9FJJJIFJJJJFJJGJFJJJJFJJIJFJJJIFJGJJFJJIJFJIJIFJFIFJJGJFJJJJFJHHJIFJJJJFHHGJJFJJJHFHJJJFJJIHHFGJJJ9FJJH4FHFJFJJIJFHHGJJFJJJIHFHFIFJJIJFHHJGJFJJJHFHJJFJFIF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 9526 6553 5367
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.07% 12.07% 2164
Spell Haste 16.68% 11.13% 1425
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 21332 13445 190
Melee Hit 8.04% 8.04% 966
Melee Crit 44.86% 30.71% 2164
Melee Haste 14.46% 11.13% 1425
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 14.07% 8.30% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.32% 11.32% 596

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 0
Bestial Discipline 1
Pathfinding 0
Spirit Bond 0
Frenzy 0
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 2
Survival Tactics 2
Trap Mastery 3
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 3
Counterattack 0
Lock and Load 2
Resourcefulness 3
Mirrored Blades 0
T.N.T. 2
Toxicology 2
Wyvern Sting 1
Noxious Stings 2
Hunting Party 1
Sniper Training 3
Serpent Spread 1
Black Arrow 1

Profile

#!./simc

hunter=Hunter_SV_T11_372
origin="http://chardev.org/?profile=34116"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
glyphs=arcane_shot/explosive_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking
actions+=/rapid_fire
actions+=/explosive_shot,non_consecutive=1
actions+=/black_arrow,if=!ticking
actions+=/kill_shot
actions+=/arcane_shot,if=focus>=70&buff.lock_and_load.down
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=5367
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2164
# gear_haste_rating=1425
# gear_mastery_rating=596
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=wind_serpent

Mage_Arcane_T11_372 : 30664dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
30663.7 15.95 / 0.05% 14.2 2154.5 1938.9 mana 0.00% 112.5
Origin http://chardev.org/?profile=35357
Talents http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
Glyphs
  • evocation
  • arcane_power
  • slow
  • mirror_image
  • arcane_brilliance
  • conjuring
  • arcane_blast
  • arcane_missiles
  • mage_armor

Charts

http://7.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:42377|36042|18748|16573|1531&chds=0,84753&chco=C41F3B,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++42377++flame_orb,C41F3B,0,0,15|t++36042++arcane_blast,69CCF0,1,0,15|t++18748++arcane_barrage,69CCF0,2,0,15|t++16573++arcane_missiles,69CCF0,3,0,15|t++1531++mirror_arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:87,8,3,2,1,0&chds=0,100&chco=69CCF0,69CCF0,C41F3B,69CCF0,69CCF0,C41F3B&chl=arcane_blast|arcane_missiles|flame_orb_tick|mirror_arcane_blast|arcane_barrage|ignite&chtt=Mage_Arcane_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s8775420zxwusrpnmlkjhgedbaYXVTSQPONOPTZgmuxyzzyxxxxyyyyyxwwxxxyyyyxwxxxxxxxwwwwxxxwwvvvwwwwvutttttuuttsssttttttssssttttstvvvutsqpomljihgfedcbaZYXWVUTSRQPOONNNNNNOQUZekpuyz0000000000zzzzyyyyyyyxxxxxxxxxxwwwxxxxxwwwwwwxwwwwwwwwwwwwvvvvwwwvvvvvvvvwwxxxwwutrqonlkjigfedcbaZYXWVTRQPOONNNNNNNNOQTXchmqtvwxyzzzz000000zzzzzyyyyyyxxxxxwwwwwwvvvvvuuuuttttssssrrrqqqqpppooooonnnnnoooooonnmmlkjihgfedcbaZZYXWVUTTSRQQPONNMMMLLLMNPQTVXZbdfhjklmnooppppppqpppppoooonnn&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=126350&chtt=Mage_Arcane_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:77877755322110yxvtrpnlkhebZXVUSQPONNNNMLKKKJKLMNNNPPQQRRSRQRSSSTTTSRSSSSTTTSRRRRSSTTSRRRSSSSSSRRSSSSTRQQQQRRRSSSSTVXZbcdeghikllmmmmmmmlkihfedcaZYXWVUTSRQPOMLKKJIIIIIIIIIIJJKLMNOPQRTTUUUUUUVVVVVWVVUUUUUTSSSSSSSRRRRRRRRRRRRRRRRRRRRRRRRRQQRRRRSSTUWXYZZabccdeefffffeeeedcbaZYXWVUTTSRQPONMKJIIIHHHIIHHIJJKLMNOPQRRSSSTTTTTTTTTTTTTTSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTUUUUVWWXYZabcdefgghhiiijiiihhgfedcbaaZYXXWVUUTSRRQPOONNMMLKKKKKKKKLLMNNOPQQRSSTUUVVVVWWWWWWWWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=30664|max=84780&chxp=1,1,36,100&chtt=Mage_Arcane_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,1,0,1,13,13,23,36,62,90,145,176,239,302,395,387,515,566,607,645,647,684,633,596,540,496,431,390,308,267,182,166,108,101,61,53,36,30,20,14,9,5,2,1,0,0,0,2&chds=0,684&chbh=5&chxt=x&chxl=0:|min=27630|avg=30664|max=34200&chxp=0,1,46,100&chtt=Mage_Arcane_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Arcane_T11_372 30664
arcane_barrage 160 0.5% 3.1 79.37sec 23549 18748 18085 37187 44515 30.8% 1.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.07 3.04 0.00 0.00 1.2561 0.0000 72262
Direct Results Count Pct Average Min Max Total Damage
hit 2.1 67.84% 18084.73 14233 21877 37354
crit 0.9 30.83% 37187.14 29247 44515 34908
miss 0.0 1.32% 0.00 0 0 0

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1915.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.907000
  • base_dd_min:1192.00
  • base_dd_max:1456.89
arcane_blast 26562 86.6% 278.1 1.63sec 43171 36042 32917 67714 136170 30.8% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
278.14 278.14 0.00 0.00 1.1978 0.0000 12007765
Direct Results Count Pct Average Min Max Total Damage
hit 188.7 67.86% 32917.07 17154 66336 6212985
crit 85.6 30.77% 67713.66 35282 136170 5794780
miss 3.8 1.37% 0.00 0 0 0

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:870.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $s1 Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast and Arcane Explosion is increased by $36032s1%, Arcane Blast casting time is reduced by ${$36032m3/-1000}.1 sec and Arcane Blast mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast or Arcane Explosion is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.057000
  • base_dd_min:1764.41
  • base_dd_max:2050.53
arcane_missiles 2303 7.5% 27.5 14.67sec 37876 16573 0 0 0 0.0% 0.0% 0.0% 0.0% 137 5475 11254 39.0% 1.4% 12.4%

Stats details: arcane_missiles

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.49 27.49 136.90 135.97 2.2854 0.4090 1041156
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 81.0 59.61% 5475.09 4353 6927 443753
crit 53.1 39.04% 11254.30 8943 14244 597403
miss 1.8 1.35% 0.00 0 0 0

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches Arcane Missiles at the enemy, causing $7268s1 Arcane damage every $5143t2 sec for $5143d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.278000
  • base_dd_min:404.93
  • base_dd_max:404.93

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches $?[five]?[four][three] waves of Arcane Missiles at the enemy over $d, causing $7268s1 Arcane damage per wave. Each offensive spell you cast has a $79684h% chance to activate Arcane Missiles.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
arcane_power 0 0.0% 4.4 119.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.43 4.43 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.4 100.00% 0.00 0 0 0

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increased damage and mana cost for your spells.
  • description:When activated, you deal $s1% more spell damage but spells cost $s2% more mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
evocation 0 0.0% 3.5 127.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: evocation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.52 3.52 0.00 0.00 4.9172 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1% of total mana every $t1 sec.
  • description:Gain $s1% of your mana instantly and another ${$m1*3}% of your total mana over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb 867 2.8% 7.8 60.86sec 50403 42377 0 0 0 0.0% 1.4% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.78 7.78 114.78 0.00 1.1894 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 98.64% 0.00 0 0 0
miss 0.1 1.36% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_tick 867 2.8% 114.8 3.73sec 3414 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2604 5367 30.6% 1.4% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.78 0.00 0.00 114.78 0.0000 0.0000 391885
Tick Results Count Pct Average Min Max Total Damage
hit 78.1 68.00% 2604.15 1655 4216 203261
crit 35.1 30.62% 5366.80 3401 8660 188623
miss 1.6 1.37% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 109 0.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 50 988 0 0.0% 0.0% 22.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 31.95 49.95 49.95 0.0000 2.0000 49356
Direct Results Count Pct Average Min Max Total Damage
hit 31.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 50.0 100.00% 988.04 443 5735 49356

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:758.40
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
presence_of_mind 0 0.0% 5.5 91.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell.
pet - mirror_image_3 794
mirror_arcane_blast 794 100.0% 78.3 14.93sec 3827 1531 3720 5580 7616 9.8% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.31 78.31 0.00 0.00 2.5000 0.0000 299726
Direct Results Count Pct Average Min Max Total Damage
hit 69.1 88.21% 3719.82 2114 5078 256961
crit 7.7 9.79% 5579.89 3171 7616 42765
miss 1.6 2.00% 0.00 0 0 0

Action details: mirror_arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing ${($m1+$M1)/2} Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1% and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.275000
  • base_dd_min:224.56
  • base_dd_max:260.98

Resources

Resource Usage Type Res% DPR RPE
Mage_Arcane_T11_372
arcane_barrage mana 0.5% 14.4 1633
arcane_blast mana 96.9% 12.7 3394
conjure_mana_gem mana 1.3% 0.0 12931
flame_orb mana 0.6% 63.3 797
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29250.3 16.2 0.8%
clearcasting none 25.0 18093.2 722.4 0.0%
evocation mana 14.1 246358.2 17476.7 0.1%
flask mana 1.0 4725.0 4725.0 0.0%
food mana 1.0 1417.5 1417.5 0.0%
initial_mana none 1.0 107548.4 107548.4 0.0%
mage_armor mana 1809.3 388061.6 214.5 0.8%
mana_gem mana 4.2 51135.1 12103.0 0.0%
master_of_elements mana 121.7 23550.4 193.6 0.3%
mp5_regen mana 1809.3 78074.5 43.2 0.8%
replenishment mana 1809.3 53939.0 29.8 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
arcane_blast 31.1 247.1 14.7sec 1.6sec 83% 96%

Database details

  • id:36032
  • cooldown name:buff_arcane_blast
  • tooltip:Arcane Blast and Arcane Explosion damage increased by $w1%. Arcane Blast casting time reduced by ${$m3/-1000}.1 sec and mana cost increased by $w2%.
  • max_stacks:4
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_missiles 28.0 102.3 15.9sec 3.5sec 65% 65%

Database details

  • id:79683
  • cooldown name:buff_arcane_missiles
  • tooltip:Arcane Missiles activated.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:40.00%
arcane_potency 29.1 1.6 15.8sec 15.0sec 18% 17%

Database details

  • id:
  • cooldown name:buff_arcane_potency
  • tooltip:(null)
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 4.4 0.0 119.8sec 119.8sec 15% 30%

Database details

  • id:12042
  • cooldown name:buff_arcane_power
  • tooltip:Increased damage and mana cost for your spells.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 179.4 98.5 2.5sec 1.6sec 74% 74%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.3sec 18.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
improved_mana_gem 4.2 0.0 124.1sec 124.1sec 14% 14%

Database details

  • id:
  • cooldown name:buff_improved_mana_gem
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.8 0.0 54.0sec 54.0sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 9.5 0.0 49.8sec 49.8sec 25% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shard_of_woe 7.8 0.0 62.0sec 62.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shard_of_woe
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.4 0.0 113.3sec 113.3sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 119.9sec 119.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 75.5 185.7sec 4.8sec 17% 17%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
focus_magic_feedback

Database details

  • id:
  • cooldown name:buff_focus_magic_feedback
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mage_armor

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
arcane_blast_0 11.2%
arcane_blast_1 10.7%
arcane_blast_2 10.5%
arcane_blast_3 10.3%
arcane_blast_4 57.2%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 4.2 124.1sec
munched_ignite 3.2 89.5sec
rolled_ignite 5.1 64.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.89%
σ of the average dps 7.9771
2 * σ / μ 0.0520%
95% Confidence Intervall ( μ ± 2σ ) ( 30647.78 - 30679.69 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 30639.80 - 30687.66 )
Sample Data
σ 797.7135
Minimum 27629.72
Maximum 34200.18
Spread ( max - min ) 6570.47
Range ( max - min ) / 2 3285.23
Range% 10.71
10th Percentile 29690.06
90th Percentile 31731.71
( 90th Percentile - 10th Percentile ) 2041.65
Approx. Iterations needed for
1% dps error 27
0.1% dps error 2707
0.1 scale factor error with delta=300 5656
0.05 scale factor error with delta=300 22625
0.01 scale factor error with delta=300 565641
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 focus_magic
3 arcane_brilliance
4 mage_armor
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
A volcanic_potion,if=!in_combat
B volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
C arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
D mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
E mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
F flame_orb,if=target.time_to_die>=10
G presence_of_mind,arcane_blast
H arcane_blast,if=target.time_to_die<60&mana_pct>4
I arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
J evocation,invulnerable=1
K evocation,if=target.time_to_die>=31
L sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
M arcane_missiles
N arcane_barrage,if=buff.arcane_blast.stack>0
O arcane_barrage,moving=1
P fire_blast,moving=1
Q ice_lance,moving=1
R restart_sequence,name=conserve

Sample Sequence

0124A9CDEGFIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLLLLMRLLLLLM9FRLLLLLNMRLLLLLMRLLLLLMRLLGLLLMRLLLLLNMRLLLLLMRLLIFI9BCDIIIIIIIIIIIIIIIIIIIIIIIIIIIILLKLMRLLLLLEFGM9RLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLFLCD79IIIIIIIIIIIIIIIIIIIIIIGLMRLILLLLKMRLLLLFLM9RLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLFGLLLMIIII9CDEIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIKFMRLLLLL9MRLLLLLNMRLLLLLGMRLLLLLNMRLLLLLMRLLLLLMRLFHHHHHHHHHHH9CDHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHMRLHGH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 631 52 20
Agility 648 68 20
Stamina 7658 6035 5972
Intellect 6116 5416 4957
Spirit 291 291 101
Health 143995 121343 0
Mana 113691 103280 0
Spell Power 9145 7613 2207
Spell Hit 15.63% 15.63% 1601
Spell Crit 24.20% 15.12% 514
Spell Haste 20.14% 14.42% 1420
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 673 32 0
Melee Hit 13.33% 13.33% 1601
Melee Crit 14.56% 6.66% 514
Melee Haste 11.09% 11.09% 1420
Expertise 0.00 0.00 0
Armor 12578 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.05% 17.05% 1622

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 3
Invocation 2
Improved Arcane Missiles 2
Improved Blink 0
Arcane Flows 2
Presence of Mind 1
Missile Barrage 2
Prismatic Cloak 3
Improved Polymorph 0
Arcane Tactics 1
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 2
Slow 1
Nether Vortex 2
Focus Magic 1
Improved Mana Gem 2
Arcane Power 1
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 2
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Arcane_T11_372
origin="http://chardev.org/?profile=35357"
level=85
race=gnome
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
glyphs=evocation/arcane_power/slow/mirror_image/arcane_brilliance/conjuring/arcane_blast/arcane_missiles/mage_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/focus_magic
actions+=/arcane_brilliance
actions+=/mage_armor
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
actions+=/arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
actions+=/flame_orb,if=target.time_to_die>=10
actions+=/presence_of_mind,arcane_blast
actions+=/arcane_blast,if=target.time_to_die<60&mana_pct>4
actions+=/arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
actions+=/evocation,invulnerable=1
actions+=/evocation,if=target.time_to_die>=31
actions+=/sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
actions+=/arcane_missiles
actions+=/arcane_barrage,if=buff.arcane_blast.stack>0
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1
actions+=/restart_sequence,name=conserve
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist=soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5972
# gear_intellect=4957
# gear_spirit=101
# gear_spell_power=2207
# gear_hit_rating=1601
# gear_crit_rating=514
# gear_haste_rating=1420
# gear_mastery_rating=1622
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# trinket2=shard_of_woe,heroic=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_Frostfire_T11_372 : 25156dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25155.8 21.10 / 0.08% 27.1 928.9 800.0 mana 0.00% 39.4
Origin http://chardev.org/?profile=88851
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • frostfire
  • pyroblast
  • molten_armor

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56204|44063|39878|14273|9301|948&chds=0,112409&chco=C41F3B,C41F3B,C41F3B,2459FF,C41F3B,2459FF&chm=t++56204++flame_orb,C41F3B,0,0,15|t++44063++living_bomb,C41F3B,1,0,15|t++39878++pyroblast_hs,C41F3B,2,0,15|t++14273++frostfire_bolt,2459FF,3,0,15|t++9301++scorch,C41F3B,4,0,15|t++948++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:47,15,14,9,7,4,2,1,0,0,0,0&chds=0,100&chco=2459FF,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=frostfire_bolt|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8777766555543332221111100zyyyyxxxxwwwwvuuuuuttttttssrrrrrrrqqqqqppooooonnnnnmmllllkkkkkkjjjiiiiihhhhhhggfffffffeeeedddcehiiihhhhgggffffffeeedddcccccccbbbbaaaaZZZZZZYYYXXXXXWWWWWVVVUTTTTSSSSRRRQQQQPPPPPOOOONNNNMMMMMLLLLKKKKJJJJJJIIIHHHHHGGGGIKLLLLKKKKKKJJJIIIIHHHHHGGGGFFFFFFEEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEFFFFFFFGGGGGGHHHHHIIIIIIIJJJJJJJJKKKKKKKKKKKKKKKKKKKKLLLLLLMMMMMMNNNNNNNNOOOOOOOOOPPPPPPPPPPPQQQQQQRRRRRSSSSSSTTTTTTTTTUUUUUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116455&chtt=Mage_Fire_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:jmqqssuwxxy125687655320xxvurqonljiggeeddddccbbaaaaZZaabbaaaaaaaZaaabbaaZZYYXXXXXYXXXWWWWVVVWWXXXXXXYYYYYZZZZZZZZYYYYYYYYYYYYYYYYZZabbbbbbccdddeefffeeedddddddddccbbaaaZZZZZZZYYYYYYYZabbccdddeefffgggfffedccbbaaZZYXXXWWWWWWXXXXWWWWWXXXYYYYYYYYYZZZaaabbbbbbbbbccccccccccccccccbbbbbbbbbbcccccccbbbbbbaaaaaZZYYYYYYYYZZZZZZZZZaaabbbbbbbbbbbbbbbbbbaaaaaZZZZZZYYYYYYYZZZabbccdeefghiijjjjjjjjjiiihhggfeedcccbbbbbaaaaaaaaaabbbbbccccddddeeeeefffffffeeeddddddddcccc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25156|max=52652&chxp=1,1,48,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,1,5,5,7,21,27,48,50,95,110,147,201,240,272,367,400,461,506,588,577,598,546,601,586,548,459,440,401,316,267,267,184,170,121,97,71,43,45,21,27,27,13,8,3,3,1,3,2,1&chds=0,601&chbh=5&chxt=x&chxl=0:|min=21641|avg=25156|max=29481&chxp=0,1,45,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_Frostfire_T11_372 25156
combustion 1813 7.2% 3.8 131.08sec 217769 0 8196 16954 22952 31.4% 0.1% 0.0% 0.0% 52 11156 23207 31.5% 0.0% 8.4%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.76 3.76 52.06 52.06 0.0000 0.7272 819594
Direct Results Count Pct Average Min Max Total Damage
hit 2.6 68.46% 8195.55 7082 11170 21117
crit 1.2 31.41% 16954.16 14552 22952 20040
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 35.6 68.48% 11155.76 3771 27462 397688
crit 16.4 31.52% 23206.97 7749 56430 380750

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:14637.72
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.2 46.36sec 3080 0 2620 4050 4434 32.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.19 10.19 0.00 0.00 0.0000 0.0000 31389
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 67.54% 2619.72 2562 2870 18035
crit 3.3 32.35% 4049.94 3959 4434 13354
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
flame_orb 1073 4.3% 7.7 61.12sec 63235 56204 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.83 0.00 1.1251 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.16sec 7217 0 5469 11239 14777 30.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55312
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.46% 5469.42 4925 7191 29114
crit 2.3 30.42% 11238.89 10121 14777 26198
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 951 3.8% 114.8 3.70sec 3744 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2820 5835 30.8% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.83 0.00 0.00 114.83 0.0000 0.0000 429887
Tick Results Count Pct Average Min Max Total Damage
hit 79.4 69.11% 2819.51 2437 3893 223764
crit 35.3 30.76% 5835.11 5008 7999 206123
miss 0.1 0.13% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
frostfire_bolt 11725 46.6% 211.6 2.12sec 25053 14273 18541 38254 54480 30.5% 0.1% 0.0% 0.0% 194 490 1010 30.4% 0.0% 98.6%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
211.61 210.95 193.92 193.92 1.7553 2.2981 5301468
Direct Results Count Pct Average Min Max Total Damage
hit 146.3 69.36% 18540.93 16101 26513 2712641
crit 64.4 30.52% 38253.56 33086 54480 2463178
miss 0.3 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.9 69.55% 489.66 244 698 66044
crit 59.0 30.45% 1009.58 524 1435 59605

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:405.75
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
ignite 3690 14.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 155 10729 0 0.0% 0.0% 68.8%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 104.96 155.49 155.49 0.0000 2.0000 1668230
Direct Results Count Pct Average Min Max Total Damage
hit 105.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 155.5 100.00% 10728.91 915 52292 1668230

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:12050.00
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4072 16.2% 35.8 12.82sec 51429 44063 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6553 13531 30.6% 0.0% 93.3%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.80 35.80 186.28 186.28 1.1672 2.2635 1618367
Direct Results Count Pct Average Min Max Total Damage
hit 35.8 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.3 69.40% 6552.53 5492 10800 847087
crit 57.0 30.60% 13530.89 11286 22191 771280

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 493 2.0% 35.8 12.67sec 6230 0 4724 9749 13716 30.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.75 35.75 0.00 0.00 0.0000 0.0000 222736
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 69.81% 4723.56 4154 6675 117906
crit 10.8 30.07% 9749.06 8536 13716 104831
miss 0.0 0.11% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2258 9.0% 21.9 19.94sec 46542 39878 21912 45181 64225 40.7% 0.1% 0.0% 0.0% 100 2358 4863 40.6% 0.0% 50.3%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.94 21.86 99.55 99.55 1.1671 2.2830 1021118
Direct Results Count Pct Average Min Max Total Damage
hit 12.9 59.18% 21912.48 19113 31256 283445
crit 8.9 40.69% 45181.45 39274 64225 401830
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 59.2 59.44% 2357.56 1985 3898 139502
crit 40.4 40.56% 4862.53 4079 8010 196342

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.1 3.88sec 11405 9301 8736 18017 23493 28.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.14 0.14 0.00 0.00 1.2262 0.0000 1586
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 71.10% 8735.55 7718 11313 864
crit 0.0 28.83% 18017.25 15859 23493 722
miss 0.0 0.07% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 573
mirror_fire_blast 117 20.5% 34.3 33.52sec 1220 0 1174 1759 2116 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.27 34.27 0.00 0.00 0.0000 0.0000 41819
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.10% 1174.08 1105 1410 35851
crit 3.4 9.90% 1759.11 1658 2116 5968
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 456 79.5% 85.7 12.82sec 1897 948 2027 3040 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.68 77.11 0.00 0.00 2.0000 0.0000 162515
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.08% 2026.78 1912 2421 139227
crit 7.7 9.94% 3039.77 2868 3631 23288
miss 0.8 0.98% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_Frostfire_T11_372
flame_orb mana 1.7% 66.1 957
frostfire_bolt mana 74.2% 17.0 1473
living_bomb mana 23.1% 19.0 2709
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29491.8 16.3 0.0%
clearcasting none 25.2 39661.4 1575.2 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 641.6 116462.9 181.5 0.0%
mana_gem mana 3.0 36306.0 12102.0 0.0%
master_of_elements mana 110.5 40469.3 366.3 0.0%
mp5_regen mana 1809.3 78693.9 43.5 0.0%
replenishment mana 1809.3 54438.3 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 212.6 0.0 2.1sec 2.1sec 81% 81%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.3 0.0 18.1sec 18.1sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 22.0 1.1 19.9sec 19.0sec 9% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.2 0.0 51.7sec 51.7sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 35% 35%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 502.7sec 502.7sec 65% 65%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.3sec 47.3sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.1sec 115.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.4sec 414.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.9sec
munched_ignite 20.2 21.3sec
rolled_ignite 8.5 46.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.68%
σ of the average dps 10.5476
2 * σ / μ 0.0839%
95% Confidence Intervall ( μ ± 2σ ) ( 25134.72 - 25176.91 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25124.17 - 25187.46 )
Sample Data
σ 1054.7647
Minimum 21641.26
Maximum 29481.40
Spread ( max - min ) 7840.14
Range ( max - min ) / 2 3920.07
Range% 15.58
10th Percentile 23857.38
90th Percentile 26564.66
( 90th Percentile - 10th Percentile ) 2707.28
Approx. Iterations needed for
1% dps error 70
0.1% dps error 7032
0.1 scale factor error with delta=300 9889
0.05 scale factor error with delta=300 39556
0.01 scale factor error with delta=300 988914
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I frostfire_bolt
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIGIDIGIFIIIIIIIIIFIIIIIGIIGFIIIIIIIFIIIIIHIFIIIIIGIFIIIIIIFIIIIIIFIIIGIIIFIIBGIHIIFDGIIIIIIFGIIIIIGFIIIIIIFGIIGIIIAFEIIHIIIIFIIGIIIIFIIIIIIFIIGIIIIFGIIIGIBIFGHIIDIIIFIIIGIIIFGIIIIIIFIIIGIIGFIIIIIIFHIIIIIIFGIIIGIJFIIIIIIFIIIIGIIFAIEIIIIIHFIIIIIIFIIIGIDIIFIIGIIIIFIIIIGIIFGIIIHIIFIIGIIIIFIIIGIIIFIIIIGIIFGIIIIIIFIHIIGIIFIII9IGIDIFIIIIIIFIIIIGIIAFIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_Frostfire_T11_372
origin="http://chardev.org/?profile=88851"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/frostfire/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/frostfire_bolt
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_T11_372 : 26062dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26062.2 21.05 / 0.08% 28.4 918.9 788.1 mana 0.00% 39.6
Origin http://chardev.org/?profile=88793
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • fireball
  • pyroblast
  • molten_armor

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56274|44125|39402|14493|9228|949&chds=0,112548&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF&chm=t++56274++flame_orb,C41F3B,0,0,15|t++44125++living_bomb,C41F3B,1,0,15|t++39402++pyroblast_hs,C41F3B,2,0,15|t++14493++fireball,C41F3B,3,0,15|t++9228++scorch,C41F3B,4,0,15|t++949++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:45,16,14,10,7,4,2,1,0,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=fireball|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777766655543333222211110zzzyyyyxxxxwwvvvvuuuuuuttttsssssrrrrrqqqpppppooooonnnmmmmllllllkkkjjjjjiiiiiihhhgggggggffffeeefikjjjjjiihhhhhgggggfffeeeeeddddddcccbbbbbbbaaaaZZZYYYYYYYXXXWVVVVUUUUTTTSSSSRRRRRRQQQPPPPPOOOOOONNNMMMMMMLLLLKKKKJJJJJJJKNOONNNNMMMMMLLLLKKKKJJJJJIIIIHHHHHHGGGGGFFFFFEEEEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEFFFFFFGGGGGHHHHHHHHIIIIIIIIJJIIIJJJJJJJJJJJJKKKKKKLLLLLLLMMMMMMMNNNNNNNNOOOOOOOOOPPPPPPPQQQQQQRRRRRSSSSSSSTTTTTTTTTUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116467&chtt=Mage_Fire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ilnossuvxxy02567786531zxwutrpnljihfedcccbbbbaaZZZZYYZZaaZZZZZZZZZZZaaaZYYXXXWXXXXXXWWVVVVUVVWWWXWXXXXXXYYYZZZZYYYYYYYXYYYYXXYYYYZZabbbbcbccdddeeeeeeeddccccccccbbaaZZZYYYYYYYXXXXXXXYZZaabbcccdddeeeeeeddcbbaaZZZYYXWWWWWWWWWWWWWWWWWWWWXXXXYYYYXYYYZZaabbbbbccccccddddddccccccccbbbbbbbbbbbbbbbbbbaaaaaaaaaZZYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZaZZZZZZZZZZZZYYYYYYYYYZZZaabbcddeffghhiijjjjjjiiiihhggffedddcccbbbbbaaaaaaaaaaaaaaabbbbbcccccdddddddddddccccccccccb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26062|max=55796&chxp=1,1,47,100&chtt=Mage_Fire_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,2,7,10,29,30,38,79,95,113,165,203,258,316,370,477,483,518,591,561,649,589,596,543,549,463,412,334,309,247,216,183,151,107,95,52,52,27,32,16,13,5,4,2,2,0,2,1,1&chds=0,649&chbh=5&chxt=x&chxl=0:|min=22557|avg=26062|max=30538&chxp=0,1,44,100&chtt=Mage_Fire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_T11_372 26062
combustion 1862 7.1% 3.9 127.80sec 216873 0 8219 17051 22952 31.1% 0.1% 0.0% 0.0% 54 11032 22992 31.8% 0.0% 8.6%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.88 3.88 53.86 53.86 0.0000 0.7243 841835
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 68.72% 8219.01 7082 11170 21923
crit 1.2 31.15% 17050.64 14552 22952 20616
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 36.7 68.15% 11031.95 3628 26879 404942
crit 17.2 31.85% 22992.09 7455 55232 394353

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13912.11
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.1 46.71sec 3081 0 2618 4047 4434 32.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.12 10.12 0.00 0.00 0.0000 0.0000 31171
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.28% 2617.65 2562 2870 17818
crit 3.3 32.61% 4047.31 3959 4434 13353
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
fireball 11744 45.1% 208.7 2.15sec 25440 14493 18535 38217 54499 35.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.70 207.93 0.00 0.00 1.7553 0.0000 5309345
Direct Results Count Pct Average Min Max Total Damage
hit 133.5 64.20% 18535.40 16106 26522 2474272
crit 74.2 35.68% 38216.72 33096 54499 2835073
miss 0.3 0.13% 0.00 0 0 0

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.124000
  • base_dd_min:898.89
  • base_dd_max:1146.36
flame_orb 1074 4.1% 7.7 61.15sec 63336 56274 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.79 0.00 1.1255 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 123 0.5% 7.7 61.21sec 7238 0 5479 11242 14777 30.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55447
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.19% 5478.69 4925 7191 29038
crit 2.3 30.67% 11241.52 10121 14777 26410
miss 0.0 0.14% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 952 3.7% 114.8 3.70sec 3748 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2819 5833 31.0% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.79 0.00 0.00 114.79 0.0000 0.0000 430263
Tick Results Count Pct Average Min Max Total Damage
hit 79.1 68.92% 2819.02 2437 3893 223014
crit 35.5 30.95% 5833.15 5008 7999 207250
miss 0.1 0.13% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 4102 15.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 165 11252 0 0.0% 0.0% 72.9%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 116.01 164.80 164.80 0.0000 2.0000 1854294
Direct Results Count Pct Average Min Max Total Damage
hit 116.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.8 100.00% 11251.64 915 42962 1854294

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:18274.35
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4066 15.6% 35.7 12.85sec 51490 44125 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6551 13523 30.8% 0.0% 93.0%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.70 35.70 185.86 185.86 1.1669 2.2627 1616355
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.7 69.23% 6551.03 5492 10800 842894
crit 57.2 30.77% 13522.78 11286 22191 773461

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 491 1.9% 35.7 12.70sec 6224 0 4716 9726 13716 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.66 35.66 0.00 0.00 0.0000 0.0000 221944
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 69.66% 4716.12 4154 6675 117144
crit 10.8 30.22% 9725.84 8536 13716 104800
miss 0.0 0.12% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2688 10.3% 26.4 16.70sec 45988 39402 21891 45135 64225 40.6% 0.1% 0.0% 0.0% 116 2356 4857 40.7% 0.0% 58.6%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.43 26.33 115.91 115.91 1.1671 2.2842 1215268
Direct Results Count Pct Average Min Max Total Damage
hit 15.6 59.23% 21890.80 19113 31256 341302
crit 10.7 40.64% 45135.38 39274 64225 482872
miss 0.0 0.14% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 68.7 59.29% 2356.31 1985 3898 161941
crit 47.2 40.71% 4856.99 4079 8010 229153

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 4.66sec 11313 9228 8805 18136 23247 26.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2259 0.0000 1705
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 72.99% 8804.99 7718 12010 969
crit 0.0 26.94% 18135.84 15859 23247 736
miss 0.0 0.07% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 574
mirror_fire_blast 117 20.5% 34.3 33.53sec 1221 0 1175 1762 2116 9.8% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.28 34.28 0.00 0.00 0.0000 0.0000 41854
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.15% 1175.06 1105 1410 35916
crit 3.4 9.83% 1762.07 1658 2116 5938
miss 0.3 1.02% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 456 79.5% 85.7 12.83sec 1898 949 2029 3043 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.71 77.14 0.00 0.00 2.0000 0.0000 162646
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.06% 2028.58 1912 2421 139362
crit 7.7 9.92% 3042.95 2868 3631 23284
miss 0.8 1.02% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_T11_372
fireball mana 73.9% 17.3 1471
flame_orb mana 1.8% 66.1 958
living_bomb mana 23.3% 19.0 2715
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29489.0 16.3 0.0%
clearcasting none 25.2 39530.6 1571.2 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 585.5 106443.2 181.8 0.0%
mana_gem mana 3.0 36307.8 12102.6 0.0%
master_of_elements mana 120.6 45135.1 374.3 0.0%
mp5_regen mana 1809.3 78686.8 43.5 0.0%
replenishment mana 1809.3 54390.5 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 209.7 0.0 2.1sec 2.1sec 79% 79%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.3 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 26.5 1.5 16.7sec 15.8sec 11% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.1sec 52.1sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 32% 32%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 516.0sec 516.0sec 68% 68%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 48.1sec 48.1sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.0sec 115.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.4sec 414.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.9 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.9sec
munched_ignite 24.3 17.8sec
rolled_ignite 7.5 50.1sec

Statistics & Data Analysis

DPS
Population
Convergence 69.68%
σ of the average dps 10.5241
2 * σ / μ 0.0808%
95% Confidence Intervall ( μ ± 2σ ) ( 26041.17 - 26083.26 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26030.64 - 26093.79 )
Sample Data
σ 1052.4147
Minimum 22557.49
Maximum 30537.52
Spread ( max - min ) 7980.02
Range ( max - min ) / 2 3990.01
Range% 15.31
10th Percentile 24773.68
90th Percentile 27476.73
( 90th Percentile - 10th Percentile ) 2703.05
Approx. Iterations needed for
1% dps error 65
0.1% dps error 6522
0.1 scale factor error with delta=300 9845
0.05 scale factor error with delta=300 39380
0.01 scale factor error with delta=300 984512
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I fireball
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIIIIIFIIIIIIIIIFIIIIIIIIIFIIIIIGIFDIIIGIHIFIIIGIIGFIIIIIIFIIIIIIFIIIIIGIFIIBGIHIIFIIIIGIIFIIIIIIFIIIIIIFIIIIIIFAGEDIIHIIIFFIIIIIIFIIIIIGIFIIIIIIFIIIGIIIBFIHIIIIIFIIIIIIFIIIIIIIJIIFGIIIIIIFIIIHIIIFGIDIIIIIFIIIIIIFIIGIIIIFIIIGAIEIIFIHIIIIIFIIIIIIFIIIGIIIFIIIIIIFGIIIGIIFHIIIIIIFIIIIGIDIFGIIIIIIFGIIIIIIFIIIIGHIFIIIIIGIF9IIIIIIFIIIGIIIFIIIIAGI4F

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_T11_372
origin="http://chardev.org/?profile=88793"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/fireball/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/fireball
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_Frostfire_T11_372 : 26032dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26032.2 12.24 / 0.05% 28.9 901.7 761.7 mana 0.01% 42.9
Origin http://chardev.org/?profile=87205
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • ice_lance
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:78589|34920|33798|24164|13718|2435|990&chds=0,157179&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++78589++deep_freeze,2459FF,0,0,15|t++34920++frostfire_orb,2459FF,1,0,15|t++33798++ice_lance,2459FF,2,0,15|t++24164++frostbolt,2459FF,3,0,15|t++13718++frostfire_bolt,2459FF,4,0,15|t++2435++water_bolt,2459FF,5,0,15|t++990++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:36,24,13,9,7,6,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostfire_bolt|ice_lance|deep_freeze|water_bolt|ignite|frostbolt|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776666555554444433211100000zzzzyyyxxxwwwvvvuuuuttsssssrrrrrqqqqppppooonnnnnmmmmmllllkkkkkjjjjjjiiiiihhhhhggggggggffffegjkkkjjjjjiiiiihhhhhhgggggggfffffeeeeeddddddcccccbbbbbbaaaaaaZZYYYYYXXXXXXWWWWWWWVVVVVUUUUUUTTTSSSSRRRRQQQQQPPPPOOONNNNNNPRSSSRRRRRRQQQQQQQPPPPPPPOOOOONNNNNNNNMMMMMMLLLLLLLLLLKKKKKKKKKKKKKJJJJJJJJJJJJJJJJJKKKKKKKKLLLLLLMMMMMMMNNNNNNNNNOOOOOOOOOOOOOOOOPPPPPPQQQQQRRRRSSSSTTTTTUUUUUUVVVVVVVWWWWWWWWXXXXXXXXXYYYYYYZZZZZaaaaaaabbbbbbbbb&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118834&chtt=Mage_Frost_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:34465677654768134210zxvxxvtsqqponmmnllkkklnplklmmmmnmpstuvvvvwvuttttvvwwwxvtrrppponmmlllllkjjjijjjjkkklkkkkkjihihgffeeefffgghijkklllllllmmmlkkkkjihhghhhhiiijjkjjjjjiihihgfeedcccbccdfghiklmnopqrrssssrrqpnmlkkjjiiiiiijjkkkkllllllllkkkkjjkjjjjjkklmmnnoooonnnnmmlllllkjihhggfffffgghhhhhhhhhhhiiijiihhgffeeeeeffggghhhhiijjjkkkkkkkkjjiihggggfgfggggghhhhhhhhhihhhhgggggghhijkmnoprrttuuuuuuttsrqonlkihgeedddddedeeeffffgggghhhhgggggghhiijkkllmmnnnnnnpppqpqppooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26032|max=41565&chxp=1,1,63,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,1,0,3,10,12,15,27,31,51,68,93,123,151,219,262,339,354,442,443,501,523,523,608,575,544,550,547,490,425,362,322,310,254,189,145,127,88,73,60,41,30,19,19,15,7,3,1,3&chds=0,608&chbh=5&chxt=x&chxl=0:|min=23776|avg=26032|max=28236&chxp=0,1,51,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_Frostfire_T11_372 26032
cold_snap 0 0.0% 1.5 386.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.49 1.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 46.96sec 3077 0 2610 4036 4434 33.7% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.07 10.07 0.00 0.00 0.0000 0.0000 30986
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 65.75% 2610.05 2562 2870 17279
crit 3.4 33.72% 4036.32 3959 4434 13707
miss 0.1 0.53% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3290 12.6% 16.1 28.77sec 92495 78589 42816 94335 151697 96.9% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.08 16.08 0.00 0.00 1.1769 0.0000 1487187
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 2.61% 42816.40 39611 62781 17996
crit 15.6 96.86% 94334.96 81395 151697 1469191
miss 0.1 0.52% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 1485 5.7% 27.6 16.51sec 24309 24164 18230 37798 50029 32.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.62 27.53 0.00 0.00 1.0060 0.0000 671387
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 67.49% 18230.42 16543 24347 338767
crit 8.8 31.96% 37797.77 33993 50029 332620
miss 0.1 0.54% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $w1%.$?$w3!=0[ Healing received reduced by $w3%.][]
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.943000
  • base_dd_min:728.34
  • base_dd_max:928.86
frostfire_bolt 9282 35.7% 175.9 2.54sec 23861 13718 17155 35980 70339 32.9% 0.5% 0.0% 0.0% 192 459 948 32.6% 0.0% 97.8%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.85 175.28 191.85 191.85 1.7394 2.3046 4195996
Direct Results Count Pct Average Min Max Total Damage
hit 116.6 66.55% 17155.14 15631 27796 2001089
crit 57.7 32.92% 35979.96 32119 70339 2076202
miss 0.9 0.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.3 67.37% 459.17 184 784 59349
crit 62.6 32.63% 948.24 377 1612 59357

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:351.69
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 834 3.2% 9.0 51.51sec 41971 34920 0 0 0 0.0% 0.6% 0.0% 0.0% 122 0 0 0.0% 0.0% 27.1%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.98 8.98 122.44 0.00 1.2019 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.43% 0.00 0 0 0
miss 0.1 0.57% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing $95969s2 Frostfire damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 834 3.2% 122.4 3.49sec 3080 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2296 4769 32.2% 0.5% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.44 0.00 0.00 122.44 0.0000 0.0000 377077
Tick Results Count Pct Average Min Max Total Damage
hit 82.4 67.28% 2296.04 2057 2934 189136
crit 39.4 32.18% 4769.30 4228 6029 187941
miss 0.7 0.54% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $w1%.$?$w3!=0[ Healing received reduced by $w3%.][]
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 6254 24.0% 71.8 6.30sec 39397 33798 0 39692 62797 99.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
71.76 71.62 0.00 0.00 1.1657 0.0000 2827156
Direct Results Count Pct Average Min Max Total Damage
crit 71.2 99.45% 39691.59 34174 62797 2827156
miss 0.4 0.55% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1889 7.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 138 6192 0 0.0% 0.0% 61.0%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 86.97 137.93 137.93 0.0000 2.0000 854051
Direct Results Count Pct Average Min Max Total Damage
hit 87.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 137.9 100.00% 6191.87 564 23965 854051

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:6812.83
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 597
mirror_fire_blast 122 20.5% 34.2 33.51sec 1277 0 1228 1841 2437 10.0% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.21 34.21 0.00 0.00 0.0000 0.0000 43692
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.02% 1228.29 1105 1625 37406
crit 3.4 9.98% 1840.80 1657 2437 6286
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 475 79.5% 85.5 12.82sec 1981 990 2117 3175 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.53 76.98 0.00 0.00 2.0000 0.0000 169413
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.12% 2117.19 1912 2778 145238
crit 7.6 9.89% 3175.45 2867 4167 24176
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2461
freeze 27 1.1% 17.0 27.42sec 714 0 540 1079 1136 33.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12141
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 65.65% 539.96 529 569 6025
crit 5.7 33.35% 1078.86 1055 1136 6116
miss 0.2 1.00% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2434 98.9% 205.6 2.19sec 5345 2435 4045 8135 10724 33.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.64 204.53 0.00 0.00 2.1949 0.0000 1099173
Direct Results Count Pct Average Min Max Total Damage
hit 134.0 65.51% 4045.30 3682 5376 541977
crit 68.5 33.49% 8134.65 7346 10724 557196
miss 2.1 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_Frostfire_T11_372
deep_freeze mana 6.2% 59.0 1567
frostbolt mana 13.8% 11.9 2037
frostfire_bolt mana 59.4% 17.3 1377
frostfire_orb mana 2.1% 44.6 940
ice_lance mana 16.5% 41.9 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29451.8 16.3 0.1%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 464.0 82499.6 177.8 0.0%
mana_gem mana 3.0 36307.7 12102.6 0.0%
master_of_elements mana 153.7 57336.2 373.1 0.0%
mp5_regen mana 1809.3 78589.1 43.4 0.1%
replenishment mana 1809.3 54294.5 30.0 0.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.5sec 187.5sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 4.1 0.0 82.6sec 82.6sec 0% 2%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 200.1 0.0 2.2sec 2.2sec 70% 70%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 33.5 48.2 13.6sec 5.5sec 77% 98%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.0sec 104.0sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.0 0.0 247.8sec 247.8sec 26% 26%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.4 0.0 429.0sec 429.0sec 74% 75%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 114.2sec 114.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 65.1sec 65.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.8sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.6 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 27.7 16.5sec
mana_gem 3.0 120.8sec
munched_ignite 10.9 37.8sec
rolled_ignite 5.9 58.7sec

Statistics & Data Analysis

DPS
Population
Convergence 71.17%
σ of the average dps 6.1182
2 * σ / μ 0.0470%
95% Confidence Intervall ( μ ± 2σ ) ( 26019.95 - 26044.42 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26013.83 - 26050.54 )
Sample Data
σ 611.8155
Minimum 23775.90
Maximum 28236.09
Spread ( max - min ) 4460.19
Range ( max - min ) / 2 2230.10
Range% 8.57
10th Percentile 25274.88
90th Percentile 26832.86
( 90th Percentile - 10th Percentile ) 1557.98
Approx. Iterations needed for
1% dps error 22
0.1% dps error 2209
0.1 scale factor error with delta=300 3327
0.05 scale factor error with delta=300 13309
0.01 scale factor error with delta=300 332727
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*15)<target.time_to_die
M frostbolt,if=!cooldown.early_frost.remains
N frostfire_bolt
O ice_lance,moving=1
P fire_blast,moving=1

Sample Sequence

01359BJDEHMNNNJNNNJNNNMNNNKNJNNNHNMNNNFGNNNNNJNNKJMNNNJANDNHCDGHMNNJNNKNJNNMNNNNNNNHNMNNNJNJNNJMNNBNNNDHNNJMNNJNJNNNJMJNNKNJHNNMNNNNNNNNEMNKDJNHNJNJMNJNNJNKGNJNMNNNJHNNNNNMFNNNNJKJBNNJNDJMNHNJNJNJKNJMJNNJNNNNNHLMNNNJNNNNMNJNDJNJNHKMNJKNJNNNJMNJNNNNNHKKMJNGNNNNENJNJMDJNNJJKNHNJMNNNNNNJNJMNKNJNNHFNNMNJNNNNNNDJJKMJJJ4NHNJNCDGHMJNJJNNJKKNJNMNJNNNNNHNMNNKNJNJNNMNJNNNDHNNJKJJMNNNNNNNNMNNNHN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.47% 16.47% 1687
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.05% 14.05% 1687
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.43% 7.43% 973

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_Frostfire_T11_372
origin="http://chardev.org/?profile=87205"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/ice_lance/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*15) actions+=/frostbolt,if=!cooldown.early_frost.remains
actions+=/frostfire_bolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1687
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=973
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_T11_372 : 28723dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28723.0 11.08 / 0.04% 22.9 1254.2 1096.8 mana 0.02% 48.7
Origin http://chardev.org/?profile=87885
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • frostbolt
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:77970|39033|35402|32167|18380|2413|992&chds=0,155939&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++77970++deep_freeze,2459FF,0,0,15|t++39033++frostfire_bolt,2459FF,1,0,15|t++35402++frostfire_orb,2459FF,2,0,15|t++32167++ice_lance,2459FF,3,0,15|t++18380++frostbolt,2459FF,4,0,15|t++2413++water_bolt,2459FF,5,0,15|t++992++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:44,18,11,10,8,4,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostbolt|ice_lance|deep_freeze|frostfire_bolt|water_bolt|ignite|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776655544333222110zzzyyxxwwwwvvuttssrrqqpoonnmmllkkjjjiiihhggggffeeeddcccbbbaaaZZZYYXXXWWWVVVUUUTTTTSSSSSSSSSSSSRRRRRRSWXXWWWWWWWWWWVWVWVVVVVVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVWWVVWWWWWWWXXXXXXXXXXXXXXXXXXXXXXXXXWWWWWWWWWVVVVVVVUUUVXaaaaaaaabbbbbbbbbbaaaaaaaaaaaaaaZZZZZZZZZZYYYYYYYYYXXXXXXXXXXXXWWWWWWWWWVVVVVVVVVVUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTSSSSSSRRRRRQQQQQQPPPPPPPPPPPPPPPPPPPPPPPPPPOOOOOOOOOOONNNNNNNNMMMMMMMLLLLLLLLMMMMMMMMMMMMMMMMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118833&chtt=Mage_Frost_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:02244566544768244320zxwyxvtrqpponnnnmmmlmnppmlmmnnnooqrrsttttttsssttuuvvvvtssrqqpoonnmmllkkjjjiiijjjkjkjjjjjjiiihhggfffefefgghiiijjjjkkkkkkkkkjjiihhghghhhiiiiiiiihihhhhggffeedccccccdegghijllnnooppppppoonmllkjjiihihhiijjkkkkkkkkkkkkkkkklklkkkkkkllmlmmmmmlllkkkkkjjjjiihggggffffffgggggghhhhhiiiiiihhhhggfgffgfggggghhhiiijjjjkkkkjjjjiiihhhhhhhhhhhhihiiiiiiiihhhhhhhhiijjklmnnopqqrrrsrrrrqppnnlljihggffffeeeeefffffggggghghghgghhhhiijjkkkllmmmmmmnnnononnnnm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28723|max=46354&chxp=1,1,62,100&chtt=Mage_Frost_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,3,3,13,20,34,37,42,74,101,145,193,227,273,348,419,440,528,555,579,591,648,585,576,563,481,462,398,348,293,227,203,148,113,94,65,42,38,33,23,7,10,2,5,4,2,0,1,0,2&chds=0,648&chbh=5&chxt=x&chxl=0:|min=26899|avg=28723|max=31139&chxp=0,1,43,100&chtt=Mage_Frost_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_T11_372 28723
cold_snap 0 0.0% 1.5 389.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.46 1.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 68 0.2% 10.0 47.30sec 3081 0 2610 4041 4434 33.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.00 10.00 0.00 0.00 0.0000 0.0000 30809
Direct Results Count Pct Average Min Max Total Damage
hit 6.7 66.96% 2610.41 2562 2870 17478
crit 3.3 32.99% 4041.08 3959 4434 13331
miss 0.0 0.05% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3217 11.2% 15.9 29.17sec 91618 77970 43182 94179 151188 95.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.87 15.87 0.00 0.00 1.1751 0.0000 1454048
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 4.93% 43181.78 39444 62570 33760
crit 15.1 95.02% 94178.60 81052 151188 1420289
miss 0.0 0.05% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 12765 44.4% 230.6 1.95sec 25022 18380 18145 37591 50029 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
230.61 229.86 0.00 0.00 1.3614 0.0000 5770276
Direct Results Count Pct Average Min Max Total Damage
hit 147.4 64.13% 18145.02 16543 24347 2674674
crit 82.3 35.83% 37591.07 33993 50029 3095602
miss 0.1 0.04% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $w1%.$?$w3!=0[ Healing received reduced by $w3%.][]
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.943000
  • base_dd_min:728.34
  • base_dd_max:928.86
frostfire_bolt 2738 9.5% 27.2 16.16sec 45443 39033 20133 44080 70103 94.5% 0.0% 0.0% 0.0% 121 361 740 71.4% 0.0% 61.3%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.24 27.15 121.43 121.43 1.1642 2.2827 1237807
Direct Results Count Pct Average Min Max Total Damage
hit 1.5 5.42% 20133.19 18456 29333 29622
crit 25.7 94.54% 44079.58 37924 70103 1131452
miss 0.0 0.04% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 34.7 28.57% 360.77 205 869 12518
crit 86.7 71.43% 740.35 421 1786 64215

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:296.29
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 842 2.9% 8.9 51.76sec 42538 35402 0 0 0 0.0% 0.0% 0.0% 0.0% 124 0 0 0.0% 0.0% 27.4%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.95 8.95 123.72 0.00 1.2016 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.96% 0.00 0 0 0
miss 0.0 0.04% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing $95969s2 Frostfire damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 842 2.9% 123.7 3.46sec 3076 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2296 4781 31.4% 0.0% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.72 0.00 0.00 123.72 0.0000 0.0000 380525
Tick Results Count Pct Average Min Max Total Damage
hit 84.8 68.54% 2296.03 2057 2934 194692
crit 38.9 31.42% 4781.17 4228 6029 185833
miss 0.1 0.05% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $w1%.$?$w3!=0[ Healing received reduced by $w3%.][]
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 5071 17.7% 61.0 7.39sec 37573 32167 0 37661 59606 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.01 60.90 0.00 0.00 1.1680 0.0000 2292483
Direct Results Count Pct Average Min Max Total Damage
crit 60.9 99.96% 37660.95 32409 59606 2292483
miss 0.0 0.04% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1113 3.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 95 5272 0 0.0% 0.0% 42.2%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 58.24 95.43 95.43 0.0000 2.0000 503163
Direct Results Count Pct Average Min Max Total Damage
hit 58.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 95.4 100.00% 5272.45 564 21321 503163

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:7584.84
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 599
mirror_fire_blast 123 20.5% 34.2 33.50sec 1278 0 1230 1843 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.23 34.23 0.00 0.00 0.0000 0.0000 43755
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.06% 1229.65 1105 1625 37480
crit 3.4 9.95% 1842.93 1657 2437 6275
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 476 79.5% 85.6 12.81sec 1984 992 2119 3179 4167 10.0% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.57 77.01 0.00 0.00 2.0000 0.0000 169744
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.02% 2119.45 1912 2778 145304
crit 7.7 9.98% 3179.17 2867 4167 24441
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2439
freeze 27 1.1% 17.0 27.43sec 706 0 540 1078 1172 31.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 11999
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 67.09% 539.72 529 588 6155
crit 5.4 31.89% 1078.27 1055 1172 5844
miss 0.2 1.02% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2412 98.9% 205.6 2.19sec 5297 2413 4042 8138 10724 32.3% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.64 204.53 0.00 0.00 2.1949 0.0000 1089311
Direct Results Count Pct Average Min Max Total Damage
hit 136.4 66.69% 4042.08 3682 5376 551361
crit 66.1 32.32% 8138.46 7346 10724 537949
miss 2.0 0.99% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_T11_372
deep_freeze mana 4.4% 58.5 1567
frostbolt mana 82.9% 12.3 2037
frostfire_orb mana 1.5% 45.3 940
ice_lance mana 10.1% 40.0 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29494.9 16.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 1157.3 205406.5 177.5 0.0%
mana_gem mana 3.0 36309.4 12103.1 0.0%
master_of_elements mana 184.4 85688.5 464.6 0.0%
mp5_regen mana 1809.3 78702.0 43.5 0.0%
replenishment mana 1809.3 54332.7 30.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.3sec 187.3sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 27.6 7.0 16.0sec 12.7sec 18% 100%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 231.3 0.0 1.9sec 1.9sec 66% 66%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.0 0.0 47.3sec 47.3sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 46.6 46.4 9.8sec 4.9sec 65% 89%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.4sec 104.4sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.5 0.0 249.6sec 249.6sec 64% 64%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.6 0.0 279.0sec 279.0sec 36% 39%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.9sec 48.9sec 25% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 112.4sec 112.4sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 64.8sec 64.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.6 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 28.2 16.2sec
mana_gem 3.0 120.7sec
munched_ignite 6.7 57.4sec
rolled_ignite 5.5 61.5sec

Statistics & Data Analysis

DPS
Population
Convergence 69.75%
σ of the average dps 5.5417
2 * σ / μ 0.0386%
95% Confidence Intervall ( μ ± 2σ ) ( 28711.94 - 28734.11 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28706.40 - 28739.65 )
Sample Data
σ 554.1661
Minimum 26898.98
Maximum 31138.97
Spread ( max - min ) 4239.99
Range ( max - min ) / 2 2119.99
Range% 7.38
10th Percentile 28031.70
90th Percentile 29453.31
( 90th Percentile - 10th Percentile ) 1421.61
Approx. Iterations needed for
1% dps error 14
0.1% dps error 1488
0.1 scale factor error with delta=300 2729
0.05 scale factor error with delta=300 10919
0.01 scale factor error with delta=300 272977
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*12)<target.time_to_die
M frostbolt
N ice_lance,moving=1
O fire_blast,moving=1

Sample Sequence

01359BJDEHMMMMMMJJMJIMMMMMMMMMJIMMMIMMMMHMMFGMMMMMMMMJKMJMMMMMAMDMMIMHCDGMMMMMMHJJMMMMMMMMMLMMMMMMJKMJMHMMMMMMMBIMMMMMDMMIJMMMHIMMMIMMMMIMJKJMMMJMMMHMMMMIMMMEJJKMDJJMMJMMMHJJMMMJMMKGMIMKMJMMMIMMMMMMMFMMMMBMMMMMMHIDMMJMMMIMMJJJMMKMJMJMHMMMMMMMMMMMMMMJMMIMMMDHJMMMMMMMMKMJMMMMMIMMMMMMHMMKMMJMMGMIMEMMMMMDIJMMMHMJKJMJIMMMMMMMMMMIMJKKMHMMMFMMMMJMMMMMMMDMJKJMMHMMJIMMMMCDGMMMMMMHIJJMMMMMMMMMMJMMMMMKMJIMHMMIMMMIMMMJMMDKMJJJJMJHJMMJMMMIMJMKMIM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.96% 16.96% 1737
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.46% 14.46% 1737
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.23% 7.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_T11_372
origin="http://chardev.org/?profile=87885"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/frostbolt/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*12) actions+=/frostbolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1737
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Paladin_Retribution_T11_372 : 27413dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27413.1 15.48 / 0.06% 34.2 801.7 773.8 mana 6.02% 56.1
Origin http://chardev.org/?profile=47301
Talents http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
Glyphs
  • the_ascetic_crusader
  • hammer_of_wrath
  • templars_verdict
  • exorcism
  • seal_of_truth

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:31809|21864|21182|11498|9595|8104|8063|2689|2393&chds=0,63618&chco=C0C0C0,C0C0C0,C79C6E,C0C0C0,C79C6E,C0C0C0,C0C0C0,C79C6E,C79C6E&chm=t++31809++exorcism,C0C0C0,0,0,15|t++21864++hammer_of_wrath,C0C0C0,1,0,15|t++21182++templars_verdict,C79C6E,2,0,15|t++11498++consecration,C0C0C0,3,0,15|t++9595++crusader_strike,C79C6E,4,0,15|t++8104++judgement_of_truth,C0C0C0,5,0,15|t++8063++holy_wrath,C0C0C0,6,0,15|t++2689++melee,C79C6E,7,0,15|t++2393++melee,C79C6E,8,0,15&chtt=Paladin_Retribution_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:17,16,13,10,8,8,7,5,5,4,4,1,1,1,0&chds=0,100&chco=C79C6E,C0C0C0,C79C6E,C79C6E,C79C6E,C0C0C0,C0C0C0,C0C0C0,336600,C0C0C0,C0C0C0,C0C0C0,C79C6E,C0C0C0,C0C0C0&chl=templars_verdict|hand_of_light|crusader_strike|melee|seal_of_truth|exorcism|censure|hammer_of_wrath|darkmoon_card_hurricane|judgement_of_truth|seals_of_command|holy_wrath|melee|ancient_fury|consecration&chtt=Paladin_Retribution_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556876556544332111110zyyxxyyyyyzzyyyyxxxwwwwvvtsqoljhgecbbbbbbaaZZYYYYYYYXXWWVVVUUUUUTTSSSSRRRRRRRQQQQQPPPQQQQQQPPPPPPPPONNOOOOOPPQQQQQRRRSSSSSSSSSSSSSSTTTUUVVWWWXXXXYYXXXXWWVVUUUUTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSSSRRRRRRRRRRRRRRRRRRRQPPPPQPQQRRRSSSSSTTTUUUTTTTTTTTSTTTTTTUUUUUUVVVVVVVWWWWWWVVVVVVUUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUTTTTTTTUUUUVVVVWWWWWXXXXXWWWWWWXXXXXXXXXYYYYZZZZaaaabbbbbbbbbbcccccccccccccccccddddddddd&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=24568&chtt=Paladin_Retribution_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y011223354567686576456544210ywwvuvvutusrrpmlkjjjjkjjiiihhhghhhhhgggffededddcccccccbcccdddddeeeeeeeeefeeeeeededdeefggghhhijjkklmmnoopoonnnmmlkkjjiihhhhhhhhhiijjklllmmmmmmmlllkjjiihggfeedddccccbbbbcbccccccdddeeefffffffffffffefeeeeddddeeefffgghhijjkklmmnnonnnmmmllkjjjiiihiihhhhiiijjjkkklllllllkkkkkjjjjiiiiiiiiiiijjjkkklllmnppppppooonnnmmllkkjjhffeeeeeeefffgghhiijkkllmnnoopppppooonmmmllkkkjjjiiiiiiijjjjkkkllllmmmmmmmmmmmllllllkkkkkkkkkjkjjjjjjjjjjjjjji&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27413|max=45228&chxp=1,1,61,100&chtt=Paladin_Retribution_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,2,1,3,17,11,18,40,41,49,78,101,164,196,229,259,370,429,448,503,521,597,637,623,602,586,561,474,468,368,314,291,213,207,144,105,92,71,38,33,27,17,19,12,2,5,4,4,3&chds=0,637&chbh=5&chxt=x&chxl=0:|min=24568|avg=27413|max=30423&chxp=0,1,49,100&chtt=Paladin_Retribution_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Paladin_Retribution_T11_372 27413
ancient_fury 208 0.8% 3.0 210.44sec 31350 0 28645 58526 103079 9.8% 0.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 94049
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 89.50% 28645.22 0 52503 76912
crit 0.3 9.76% 58526.49 0 103079 17137
dodge 0.0 0.74% 0.00 0 0 0

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Fury, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.061000
  • base_dd_min:207.04
  • base_dd_max:280.11
censure 2024 7.4% 394.9 1.15sec 2317 0 0 0 0 0.0% 0.7% 0.0% 0.0% 196 4233 8711 9.8% 0.0% 99.8%

Stats details: censure

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
394.95 394.95 195.82 195.82 0.0000 2.3044 914950
Direct Results Count Pct Average Min Max Total Damage
hit 392.1 99.29% 0.00 0 0 0
dodge 2.8 0.71% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 176.6 90.18% 4232.51 693 6761 747401
crit 19.2 9.82% 8710.91 1427 13928 167549

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Holy damage every $t1 sec.
  • description:Holy damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
consecration 131 0.5% 4.3 94.57sec 13848 11498 0 0 0 0.0% 0.0% 0.0% 0.0% 53 1020 1575 17.3% 0.0% 9.3%

Stats details: consecration

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.26 4.26 52.93 52.93 1.2044 0.7911 59041
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 43.8 82.73% 1019.60 750 1439 44647
crit 9.1 17.27% 1574.81 1159 2201 14394

Action details: consecration

Static Values
  • id:81297
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:81.33
  • base_dd_max:81.33
crusader_strike 3584 13.1% 111.6 4.04sec 14519 9595 11492 23682 33559 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
111.59 111.59 0.00 0.00 1.5131 0.0000 1620182
Direct Results Count Pct Average Min Max Total Damage
hit 83.9 75.16% 11491.79 10593 16291 963866
crit 27.7 24.84% 23681.92 21823 33559 656316

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1639.4
  • cooldown:3.72
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.35
darkmoon_card_hurricane 1263 4.6% 92.9 5.37sec 6141 0 5562 11458 11458 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
92.95 92.95 0.00 0.00 0.0000 0.0000 570836
Direct Results Count Pct Average Min Max Total Damage
hit 83.8 90.17% 5561.88 5150 5562 466164
crit 9.1 9.83% 11457.55 10609 11458 104672

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
divine_plea 0 0.0% 3.2 131.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_plea

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.21 3.21 0.00 0.00 1.1989 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.2 100.00% 0.00 0 0 0

Action details: divine_plea

Static Values
  • id:54428
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • description:You gain $o1% of your total mana over $d, but the amount healed by your healing spells is reduced by $s2%.
exorcism 2292 8.4% 27.5 15.92sec 37645 31809 28894 44623 65765 17.2% 0.0% 0.0% 0.0% 79 1930 2982 17.2% 0.0% 34.9%

Stats details: exorcism

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.52 27.52 78.87 78.87 1.1835 2.0000 1035878
Direct Results Count Pct Average Min Max Total Damage
hit 22.8 82.84% 28894.31 20656 42567 658686
crit 4.7 17.16% 44622.76 31914 65765 210655
Tick Results Count Pct Average Min Max Total Damage
hit 65.3 82.76% 1930.28 1380 2842 126000
crit 13.6 17.24% 2982.13 2132 4392 40537

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:7026.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Holy damage per $t2 sec.
  • description:Causes ${(($m1+$M1)/2)+(0.344*$cond($gt($SP,$AP),$SP,$AP))} Holy damage $?s54934[plus ${($m1+$M1)/2*0.0688} over $d ][]to an enemy target. If the target is Undead or Demon, it will always critically hit.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2590.76
  • base_dd_max:2892.33
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.066667
  • base_td:184.28
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
hammer_of_wrath 1420 5.2% 19.5 23.98sec 32998 21864 18974 39103 51898 69.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.46 19.46 0.00 0.00 1.5093 0.0000 642008
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 30.33% 18974.30 12395 25193 111956
crit 13.6 69.67% 39102.90 25533 51898 530052

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • tree:retribution
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • base_cost:-2810.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a hammer that strikes an enemy for $s1 Holy damage. Only usable on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:3814.27
  • base_dd_max:4215.78
hand_of_light 4252 15.5% 176.8 2.55sec 10869 0 10869 0 39962 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.85 176.85 0.00 0.00 0.0000 0.0000 1922146
Direct Results Count Pct Average Min Max Total Damage
hit 176.8 100.00% 10868.94 4240 39962 1922146

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:23940.49
  • base_dd_max:23940.49
holy_wrath 340 1.2% 15.8 26.34sec 9706 8063 8877 13705 18877 17.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.83 15.83 0.00 0.00 1.2038 0.0000 153681
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 82.82% 8876.72 6492 12487 116392
crit 2.7 17.18% 13704.89 10030 18877 37288

Action details: holy_wrath

Static Values
  • id:2812
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:4684.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:Sends bolts of holy power in all directions, causing ${0.61*$SPH+$m1} Holy damage divided among all targets within $a1 yds and stunning all Demons$?s56420[, Dragonkin, Elementals,][] and Undead for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.610000
  • base_dd_min:2401.81
  • base_dd_max:2401.81
inquisition 0 0.0% 12.2 38.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.15 12.15 0.00 0.00 1.1712 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • tree:retribution
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases Holy damage done by $s1%.
  • description:Consumes all Holy Power to increase your Holy Damage by $s1%. Lasts $d per charge of Holy Power consumed.
judgement_of_truth 979 3.6% 36.2 12.59sec 12233 8104 9937 20480 33880 21.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: judgement_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.16 36.16 0.00 0.00 1.5095 0.0000 442376
Direct Results Count Pct Average Min Max Total Damage
hit 28.3 78.22% 9937.20 5617 16447 281107
crit 7.9 21.78% 20479.95 11570 33880 161269

Action details: judgement_of_truth

Static Values
  • id:31804
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1171.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${1+0.223*$SPH+0.142*$AP} Holy damage to an enemy, increased by 10% for each application of Censure on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
melee 2683 9.8% 162.5 2.79sec 7465 2689 7151 14727 21084 9.8% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
162.48 162.48 0.00 0.00 2.7759 0.0000 1212978
Direct Results Count Pct Average Min Max Total Damage
hit 107.6 66.25% 7150.70 6573 10235 769764
crit 15.9 9.81% 14726.68 13539 21084 234615
glance 38.9 23.94% 5362.54 4929 7676 208599

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth 2326 8.5% 421.5 1.07sec 2495 0 2259 4655 6715 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
421.45 421.45 0.00 0.00 0.0000 0.0000 1051500
Direct Results Count Pct Average Min Max Total Damage
hit 380.0 90.17% 2259.44 358 3260 858626
crit 41.4 9.83% 4654.51 738 6715 192875

Action details: seal_of_truth

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3279.1
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
seals_of_command 976 3.6% 422.5 1.07sec 1044 0 946 1948 2798 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seals_of_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
422.46 422.46 0.00 0.00 0.0000 0.0000 441148
Direct Results Count Pct Average Min Max Total Damage
hit 381.0 90.18% 945.82 671 1358 360342
crit 41.5 9.82% 1948.19 1382 2798 80806

Action details: seals_of_command

Static Values
  • id:20424
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Seal of Righteousness, Seal of Truth, and Seal of Justice now also deal $s1% weapon damage when triggered.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.07
templars_verdict 4608 16.8% 65.3 6.85sec 31915 21182 25908 53379 76800 21.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
65.26 65.26 0.00 0.00 1.5067 0.0000 2082729
Direct Results Count Pct Average Min Max Total Damage
hit 51.0 78.14% 25908.30 23940 37281 1321082
crit 14.3 21.86% 53378.85 49317 76800 761647

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant weapon attack that causes a percentage of weapon damage. Consumes all charges of Holy Power to increase damage dealt: 1 Holy Power: $% Weapon Damage 2 Holy Power: $% Weapon Damage 3 Holy Power: $% Weapon Damage
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.35
pet - guardian_of_ancient_kings 445
melee 445 100.0% 34.0 9.99sec 4351 2393 4629 0 4629 0.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.00 34.00 0.00 0.00 1.8182 0.0000 147922
Direct Results Count Pct Average Min Max Total Damage
hit 25.8 75.97% 4628.68 4629 4629 119564
glance 8.2 24.03% 3471.51 3472 3472 28359

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Paladin_Retribution_T11_372
consecration mana 15.2% 1.1 12882
crusader_strike mana 50.5% 8.9 1639
holy_wrath mana 20.5% 2.1 4684
inquisition holy_power 16.1% 0.0 2
judgement_of_truth mana 11.7% 10.4 1171
templars_verdict holy_power 83.9% 16675.7 2
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29268.0 16.2 0.8%
divine_plea mana 114.7 9605.5 83.7 0.0%
holy_power_crusader_strike holy_power 111.6 147.3 1.3 0.9%
initial_mana none 1.0 25122.0 25122.0 0.0%
judgements_of_the_bold mana 1339.2 194346.3 145.1 0.9%
mp5_regen mana 1809.3 105259.0 58.2 0.6%
replenishment mana 1809.3 11275.8 6.2 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 89.5 300.7sec 3.6sec 13% 100%

Database details

  • id:86700
  • cooldown name:buff_ancient_power
  • tooltip:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.3 0.0 121.1sec 121.1sec 19% 20%

Database details

  • id:31884
  • cooldown name:buff_avenging_wrath
  • tooltip:All damage and healing caused increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 9.1 0.0 52.6sec 52.6sec 30% 30%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
divine_plea 3.2 0.0 131.6sec 131.6sec 6% 6%

Database details

  • id:54428
  • cooldown name:buff_divine_plea
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
divine_purpose 27.9 0.4 15.8sec 15.6sec 12% 34%

Database details

  • id:90174
  • cooldown name:buff_divine_purpose
  • tooltip:Next Holy Power ability consumes no Holy Power and casts as if 3 Holy Power were used.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:15.00%
golemblood_potion 2.0 0.0 414.3sec 414.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
inquisition 4.0 8.1 116.1sec 38.7sec 97% 98%

Database details

  • id:84963
  • cooldown name:buff_inquisition
  • tooltip:Increases Holy damage done by $s1%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_bold 19.0 17.2 24.3sec 12.6sec 74% 74%

Database details

  • id:89906
  • cooldown name:buff_judgements_of_the_bold
  • tooltip:Regaining ${$m1/10}% of your base mana per second.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.5 9.0 35.9sec 20.3sec 44% 46%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
the_art_of_war 27.8 4.7 16.0sec 13.7sec 22% 100%

Database details

  • id:
  • cooldown name:buff_the_art_of_war
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
zealotry 3.9 0.0 125.5sec 125.5sec 17% 17%

Database details

  • id:85696
  • cooldown name:buff_zealotry
  • tooltip:Crusader Strike generates 3 charges of Holy Power.
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
guardian_of_ancient_kings-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
censure

Database details

  • id:31803
  • cooldown name:buff_censure
  • tooltip:Holy damage every $t1 sec.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_pure

Database details

  • id:53657
  • cooldown name:buff_judgements_of_the_pure
  • tooltip:Casting and melee speed increased by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 92.9 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 71.25%
σ of the average dps 7.7391
2 * σ / μ 0.0565%
95% Confidence Intervall ( μ ± 2σ ) ( 27397.66 - 27428.61 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27389.92 - 27436.35 )
Sample Data
σ 773.9120
Minimum 24568.41
Maximum 30422.56
Spread ( max - min ) 5854.15
Range ( max - min ) / 2 2927.08
Range% 10.68
10th Percentile 26465.01
90th Percentile 28431.75
( 90th Percentile - 10th Percentile ) 1966.74
Approx. Iterations needed for
1% dps error 31
0.1% dps error 3188
0.1 scale factor error with delta=300 5323
0.05 scale factor error with delta=300 21295
0.01 scale factor error with delta=300 532390
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 seal_of_truth
3 snapshot_stats
4 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
5 auto_attack
6 judgement,if=buff.judgements_of_the_pure.down
7 guardian_of_ancient_kings
8 avenging_wrath,if=buff.zealotry.down
9 zealotry,if=buff.avenging_wrath.down
A inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
B templars_verdict,if=holy_power=3
C crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
D templars_verdict,if=buff.divine_purpose.react
E crusader_strike
F hammer_of_wrath
G exorcism,if=buff.the_art_of_war.react
H judgement,if=buff.judgements_of_the_pure.remains<2
I wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
J judgement
K holy_wrath
L consecration
M divine_plea

Sample Sequence

01245678ABEFEGEBCDCDEB9CBBEBCBBBEADEBCDGEJKEBLEJGCDIIEBIIEJIIEKDAEBJEMIIIIIELGEBJEIIIIIEKJDEBIIIIIEJIIIIIEIIIIIEAJEKIIIIIE8FEBGEFJEGFCBBEJGEKIIIIIE9ABBEBJCBBBEBIIIEBIIEJIIEKIIIIIEBJEGAEGDEBGEJKEGDEBGEJMEKIIIIIEBIIEJIIEGAEBGEJKELIIIIIEB8FEJIIIIIEFIIIIIEBJEFKEJEAIGEJEKIIE9BIIIIIEBJEBGEBJEBKEBGE7GJEIIIIIEADCDIIIEJIIEBIIEKIIIIIEJDEBMEJLEKIIIEADEJDEGIIIIIEBGE8FJEKFCBBEFDCAIIIFEBJEKIIIIEGJE9BDEBJEBKEBDEAGEJIIIGEKIIIIIEBIIEJIIEIIIIIEBFEGJEFDEABEFGEJKEBFEJMEFLEBIIEFIIE8IIIIIIIIIIIIIIIIFEAJIIEFIIIIIEJCBBEFG4EJDEBFEJKEFIIIIIE9AJEBFEBIIIEBFEBG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7109 5784 5345
Agility 699 117 20
Stamina 7711 6086 5930
Intellect 132 126 20
Spirit 141 141 20
Health 150923 128229 0
Mana 25122 25032 0
Spell Power 5442 3708 0
Spell Hit 17.47% 17.47% 970
Spell Crit 14.08% 9.07% 993
Spell Haste 10.90% 5.61% 719
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 16086 11974 190
Melee Hit 8.08% 8.08% 970
Melee Crit 14.64% 6.77% 993
Melee Haste 5.61% 5.61% 719
Expertise 23.15 13.15 395
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.42% 4.51% 83
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.06% 19.06% 1982

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
tabard empty

Talents

Holy Rank
Arbiter of the Light 2
Protector of the Innocent 0
Judgements of the Pure 3
Clarity of Purpose 0
Last Word 0
Blazing Light 2
Denounce 0
Divine Favor 0
Infusion of Light 0
Daybreak 0
Enlightened Judgements 0
Beacon of Light 0
Speed of Light 0
Sacred Cleansing 0
Conviction 0
Aura Mastery 0
Paragon of Virtue 0
Tower of Radiance 0
Blessed Life 0
Light of Dawn 0
Protection Rank
Divinity 0
Seals of the Pure 2
Eternal Glory 0
Judgements of the Just 0
Toughness 0
Improved Hammer of Justice 0
Hallowed Ground 0
Sanctuary 0
Hammer of the Righteous 0
Wrath of the Lightbringer 0
Reckoning 0
Shield of the Righteous 0
Grand Crusader 0
Vindication 0
Holy Shield 0
Guarded by the Light 0
Divine Guardian 0
Sacred Duty 0
Shield of the Templar 0
Ardent Defender 0
Retribution Rank
Eye for an Eye 2
Crusade 3
Improved Judgement 2
Guardian's Favor 0
Rule of Law 3
Pursuit of Justice 2
Communion 1
The Art of War 3
Long Arm of the Law 2
Divine Storm 1
Sacred Shield 1
Sanctity of Battle 1
Seals of Command 1
Sanctified Wrath 3
Selfless Healer 0
Repentance 1
Divine Purpose 2
Inquiry of Faith 3
Acts of Sacrifice 0
Zealotry 1

Profile

#!./simc

paladin=Paladin_Retribution_T11_372
origin="http://chardev.org/?profile=47301"
level=85
race=human
role=hybrid
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
glyphs=the_ascetic_crusader/hammer_of_wrath/templars_verdict/exorcism/seal_of_truth
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/seal_of_truth
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
actions+=/auto_attack
actions+=/judgement,if=buff.judgements_of_the_pure.down
actions+=/guardian_of_ancient_kings
actions+=/avenging_wrath,if=buff.zealotry.down
actions+=/zealotry,if=buff.avenging_wrath.down
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
actions+=/templars_verdict,if=holy_power=3
actions+=/crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
actions+=/templars_verdict,if=buff.divine_purpose.react
actions+=/crusader_strike
actions+=/hammer_of_wrath
actions+=/exorcism,if=buff.the_art_of_war.react
actions+=/judgement,if=buff.judgements_of_the_pure.remains<2
actions+=/wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
actions+=/judgement
actions+=/holy_wrath
actions+=/consecration
actions+=/divine_plea
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders=reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
chest=reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs=reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands=reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
# Gear Summary # gear_strength=5345
# gear_agility=20
# gear_stamina=5930
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=395
# gear_hit_rating=970
# gear_crit_rating=993
# gear_haste_rating=719
# gear_mastery_rating=1982
# gear_armor=21168
# gear_dodge_rating=83
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide

Priest_Disc_Smite_T11_372 : 12678dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
12677.7 175.28 / 1.38% 6.7 1905.8 1742.1 mana 27.58% 32.3
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGszRsbcRMo0hZhb0b
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:29395|27430|25811|24268|17857|12359|7836&chds=0,58791&chco=9482C9,C0C0C0,9482C9,C0C0C0,C0C0C0,C0C0C0,9482C9&chm=t++29395++devouring_plague,9482C9,0,0,15|t++27430++holy_fire,C0C0C0,1,0,15|t++25811++shadow_word_pain,9482C9,2,0,15|t++24268++power_word_shield,C0C0C0,3,0,15|t++17857++penance,C0C0C0,4,0,15|t++12359++smite,C0C0C0,5,0,15|t++7836++melee,9482C9,6,0,15&chtt=Priest_Disc_Smite_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:48,28,22,21,13,13,11,7,4,1&chds=0,100&chco=C0C0C0,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9,9482C9,C0C0C0,9482C9,C41F3B&chl=atonement|penance|smite|holy_fire|power_word_shield|shadow_word_pain|devouring_plague|divine_aegis|melee|darkmoon_card_volcano&chtt=Priest_Disc_Smite_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s75567776567654234430zyxwuttttuuvwwvttssuwvvutrqqsrqrppooomnoopqstuvvtuuvuuttsrrqqpnooopppqpoonnpqrstw001101120011111zyyxwwwxxyyyywwyzzyxwvusqrssrrpoppomnnnnopqqqrrsrqppponmmllkjjjjkkjjjjihhiiilllkkigggfeeeefffddcbbbcccccddccdeddcbbZYXVVWWVUUTSSSRRRRSSUVWWXWUTTSRRRQPPPPNNNNONMNNNMLLLONPPPONMLKJIHHHHHIHHHGGFFFFGFFGHHIIIHHGGFEDDCCCCCCCCCCBBCCCCCDEFFFEEDDCCBBBCCEFHIJKLMNNOOOPQQRRRRRQQQQPPOOONNNNNORTWZbdfhiklllmmmmllkjihhhhhhhgggfeeeeefgghhhgffeeeddccb&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=124954&chtt=Priest_Disc_Smite_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z002345543444487441yvsqnkjjihgecdddcdedeeeghhhehghjlkjijhfhgghjhhijjhgfcdefhgggdbaYZabccdcededfhgjlnpprrponnooonmmjgeccaZZbbcdeeddefgiiikmmjkllllkjihgebbbbbcbZbbcbaZYZacdeeecaZYacdeeccccdddeefhijkjjhggfhiigfecbYWXWXXYZbbcbaacdfhhiiikihjjjkiigfedbbbZZabcbddbbaabcdeeedcabbcddecbccddddeeghijjjigfffggffdbaZWVVVVWWXYZZZZZabbcccccbbaaaZYXWVUTTSSTTTUUVVVVVVVVWWWWXWWWVVWWWXYZabcdefgghhhhhhggggffedcbaZZZZZZaabbcccdefgghhhggffggghggfeeddcccccddeedcbbbbbccddd&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=12678|max=24577&chxp=1,1,52,100&chtt=Priest_Disc_Smite_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,3,3,5,11,11,18,41,56,79,106,149,195,255,291,349,413,479,545,549,604,588,611,550,571,537,473,420,389,351,301,232,194,152,123,93,62,48,43,23,23,16,17,5,7,2,4,1,1&chds=0,611&chbh=5&chxt=x&chxl=0:|min=19720|avg=12678|max=23335&chxp=0,1,-195,100&chtt=Priest_Disc_Smite_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Disc_Smite_T11_372 12678
archangel 0 0.0% 14.9 30.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.90 14.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
atonement 6129 48.3% 481.4 0.94sec 5757 0 5058 7955 48887 24.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: atonement

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
481.43 481.43 0.00 0.00 0.0000 0.0000 2771543
Direct Results Count Pct Average Min Max Total Damage
hit 365.4 75.89% 5058.41 495 31642 1848100
crit 116.1 24.11% 7955.22 765 48887 923443

Action details: atonement

Static Values
  • id:81751
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:(null)
  • description:When you deal damage with Smite, you instantly heal a nearby low health friendly target within $81751A yards from the enemy target equal to a percentage of the damage dealt.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:869.00
  • base_dd_max:869.00
darkmoon_card_volcano 73 0.6% 10.2 46.46sec 3219 0 2814 4350 4543 26.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.19 10.19 0.00 0.00 0.0000 0.0000 32787
Direct Results Count Pct Average Min Max Total Damage
hit 7.5 73.64% 2813.66 2773 2940 21107
crit 2.7 26.36% 4349.60 4284 4543 11680

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1425 11.2% 19.0 24.36sec 33984 29395 0 0 0 0.0% 0.0% 0.0% 0.0% 199 2848 4443 24.6% 0.0% 94.8%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.96 18.96 198.88 198.88 1.1561 2.1564 644299
Direct Results Count Pct Average Min Max Total Damage
hit 19.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.0 75.43% 2847.57 2566 3398 427158
crit 48.9 24.57% 4443.00 3965 5250 217141

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_aegis 943 7.4% 116.1 3.87sec 3673 0 3673 0 26440 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
116.08 116.08 0.00 0.00 0.0000 0.0000 426397
Direct Results Count Pct Average Min Max Total Damage
hit 116.1 100.00% 3673.30 338 26440 426397

Action details: divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Critical heals have a chance to create a protective shield on the target, absorbing a percentage of the amount healed. Lasts $d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:293.17
  • base_dd_max:293.17
holy_fire 2709 21.4% 38.6 11.82sec 31739 27430 21744 33950 43472 24.0% 0.0% 0.0% 0.0% 374 642 1001 24.1% 0.0% 59.3%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.60 38.60 374.32 374.32 1.1571 0.7170 1225096
Direct Results Count Pct Average Min Max Total Damage
hit 29.3 76.02% 21744.26 15206 28137 638018
crit 9.3 23.98% 33949.85 23493 43472 314298
Tick Results Count Pct Average Min Max Total Damage
hit 284.3 75.94% 642.34 454 828 182590
crit 90.1 24.06% 1001.47 701 1279 90190

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.110000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.031200
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
penance 3592 28.3% 36.7 12.35sec 44226 17857 0 0 0 0.0% 0.0% 0.0% 0.0% 150 9559 14897 24.4% 0.0% 18.1%

Stats details: penance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.72 36.72 149.86 149.54 2.4767 0.5460 1624188
Direct Results Count Pct Average Min Max Total Damage
none 36.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 113.1 75.61% 9558.78 6654 12142 1080777
crit 36.5 24.39% 14896.77 10281 18760 543410

Action details: penance_tick

Static Values
  • id:47666
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.458000
  • base_dd_min:699.38
  • base_dd_max:790.24

Action details: penance

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • tree:discipline
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2882.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
power_infusion 0 0.0% 4.3 122.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.28 4.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3294.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
power_word_shield 1666 13.1% 27.0 17.02sec 27905 24268 27905 0 37307 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.00 27.00 0.00 0.00 1.1499 0.0000 753475
Direct Results Count Pct Average Min Max Total Damage
hit 27.0 100.00% 27905.33 25660 37307 753475

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6300.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $ damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.870000
  • base_dd_min:8136.94
  • base_dd_max:8136.94
shadow_fiend 0 0.0% 1.9 300.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.87 1.87 0.00 0.00 1.1805 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1606 12.7% 24.6 18.65sec 29566 25811 0 0 0 0.0% 0.0% 0.0% 0.0% 205 3115 4861 24.1% 0.0% 97.4%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.57 24.57 205.46 205.46 1.1455 2.1432 726484
Direct Results Count Pct Average Min Max Total Damage
hit 24.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 155.9 75.89% 3115.06 2882 3787 485695
crit 49.5 24.11% 4860.80 4452 5851 240789

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 2784 22.0% 68.5 6.46sec 18377 12359 16152 25245 39933 24.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.52 68.52 0.00 0.00 1.4869 0.0000 1259112
Direct Results Count Pct Average Min Max Total Damage
hit 51.8 75.53% 16151.81 11612 25847 835882
crit 16.8 24.47% 25244.73 17941 39933 423230

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.$?s55692[ Damage is increased by $55692s1% if the target is afflicted by Holy Fire.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 618
melee 618 100.0% 20.9 13.79sec 10595 7836 7921 21367 26819 23.4% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.88 20.88 0.00 0.00 1.3522 0.0000 221216
Direct Results Count Pct Average Min Max Total Damage
hit 11.0 52.64% 7920.80 505 10057 87049
crit 4.9 23.38% 21366.95 1346 26819 104303
glance 5.0 23.98% 5963.99 379 7543 29864

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.5 60.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.52 5.52 0.00 0.00 1.5289 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Disc_Smite_T11_372
devouring_plague mana 10.0% 7.5 4529
holy_fire mana 10.9% 13.0 2438
penance mana 17.7% 10.7 4144
power_infusion mana 1.3% 0.0 2525
power_word_shield mana 19.1% 4.6 6112
shadow_word_pain mana 11.3% 7.4 3973
smite mana 29.7% 4.9 3735
Resource Gains Type Count mana Average Overflow
archangel mana 14.9 100888.3 6770.2 1.3%
blessing_of_might mana 1809.3 29367.8 16.2 0.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 4.3 12075.1 2807.8 0.0%
hymn_of_hope_max_mana mana 0.9 16060.8 18736.3 0.0%
initial_mana none 1.0 117810.0 117810.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.3 92686.7 51.2 0.4%
rapture mana 27.0 251375.7 9309.8 1.4%
replenishment mana 1809.3 60881.5 33.6 0.4%
shadow_fiend mana 20.9 88346.6 4231.4 1.3%
spirit_intellect_regen mana 1809.3 120283.7 66.5 0.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
borrowed_time 27.0 0.0 17.0sec 17.0sec 36% 33%

Database details

  • id:59888
  • cooldown name:buff_borrowed_time
  • tooltip:$s1% spell haste until next spell cast.
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:200.00%
casting 107.4 0.0 4.2sec 4.2sec 31% 31%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.5sec 46.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 14.9 0.0 30.7sec 30.7sec 58% 61%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 15.9 91.3 29.3sec 4.2sec 91% 85%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 0.9 3.4 0.0sec 1.5sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.8sec 51.8sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_infusion 4.3 0.0 122.0sec 122.0sec 14% 16%

Database details

  • id:
  • cooldown name:buff_power_infusion
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.9sec 46.9sec 26% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 1.9 0.0 300.4sec 0.0sec 6% 6%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 1.9 0.1 126.4sec 114.5sec 4% 4%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 3.8 0.0 128.1sec 128.1sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
weakened_soul 27.0 0.0 17.0sec 17.0sec 88% 88%

Database details

  • id:6788
  • cooldown name:buff_weakened_soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 5.5 0.0 60.3sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 15.3%
holy_evangelism_1 8.2%
holy_evangelism_2 7.1%
holy_evangelism_3 7.7%
holy_evangelism_4 12.6%
holy_evangelism_5 49.2%

Procs

Count Interval
surge_of_light 2.1 114.3sec

Statistics & Data Analysis

DPS
Population
Convergence 3.86%
σ of the average dps 87.6381
2 * σ / μ 1.3826%
95% Confidence Intervall ( μ ± 2σ ) ( 12502.44 - 12853.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 98.62% - 101.38% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 12414.81 - 12940.63 )
Sample Data
σ 8763.8087
Minimum 19720.05
Maximum 23335.06
Spread ( max - min ) 3615.02
Range ( max - min ) / 2 1807.51
Range% 14.26
10th Percentile 20823.01
90th Percentile 22047.34
( 90th Percentile - 10th Percentile ) 1224.34
Approx. Iterations needed for
1% dps error 19114
0.1% dps error 1911452
0.1 scale factor error with delta=300 682705
0.05 scale factor error with delta=300 2730821
0.01 scale factor error with delta=300 68270526
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 power_infusion
A archangel,if=buff.holy_evangelism.stack>=5
B power_word_shield,if=buff.weakened_soul.down
C holy_fire
D devouring_plague,if=remains<tick_time|!ticking
E shadow_word_pain,if=remains<tick_time|!ticking
F penance
G smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCD5EFGGGGAGGCGFBGGEGCDFBCFEAGGGCFBDGECFBCFADEGGGGBCFECF6BDAGGCFGEGBCFD9CBEFAGGGGGCFBDGECFBCAFEDGGGGBCF8ECFBDAGGGCFEGBCFDEBCFAGGGGGCFBDEG9CFBAGCEFDGGGBCFECFBDAGGGGCFEGBCFDEBCAFGGGGGCFECDABFCEGG8FC9ECABDFGGGGCE67BCDAFEGGGGCFBDECFBAGGGCFGEGDBCFCEBAFGGDGCGFBE9CFDBACFEGGGGCFBEDCFBAGGGCF8EGD

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6994 6191 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 123660 113160 0
Spell Power 10695 8388 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 19.50% 13.27% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 3
Soul Warding 0
Renewed Hope 1
Power Infusion 1
Atonement 2
Inner Focus 1
Rapture 3
Borrowed Time 2
Reflective Shield 0
Strength of Soul 0
Divine Aegis 3
Pain Suppression 1
Train of Thought 2
Focused Will 0
Grace 2
Power Word: Barrier 1
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 3
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 0
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 2
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Disc_Smite_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/power_infusion
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/power_word_shield,if=buff.weakened_soul.down
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/penance
actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Holy_Smite_AA_T11_372 : 9971dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
9970.5 5.08 / 0.05% 6.9 1437.1 1279.4 mana 45.50% 27.7
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGoZfuRrRkbkMdo0o
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:27146|23413|20898|13117|6806&chds=0,54291&chco=C0C0C0,9482C9,9482C9,C0C0C0,9482C9&chm=t++27146++holy_fire,C0C0C0,0,0,15|t++23413++devouring_plague,9482C9,1,0,15|t++20898++shadow_word_pain,9482C9,2,0,15|t++13117++smite,C0C0C0,3,0,15|t++6806++melee,9482C9,4,0,15&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:38,28,15,14,5,1&chds=0,100&chco=C0C0C0,C0C0C0,9482C9,9482C9,9482C9,C41F3B&chl=smite|holy_fire|shadow_word_pain|devouring_plague|melee|darkmoon_card_volcano&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t6677655543210yxvtrpoooomllmmnnnooooonopponnlljjjjjlmnpqrtuwxz12233445654210yyxxvuuvvvwwxxxyyxwvuuuwyyxxwvutsrqppoonnnonmmmnnnnnoprqqonmmkkjhhhhggghhhhggggghhijllkkiihfecbZYYXXYYYZZaaababbbcddcbaaZYXWWUUUVVVVVUUUUUVUTTTUVWWVUTTRQPNMMMMMNNNNMMMMMMMMMMOPPONMMLKJIHGFFFEEEEEEEEFFFFFGHJIIHGFFEDCCCCCCCCCDDDDDCCCCDDEFFEDDCCCCCBBBBBBBBBBBBBCCBBBCCEEDDCCCCEHMSWZcehjkkkllllllmmnopoonmkjihgfeedddeeeffffeeeeffhihggfdcbaZYXXWWWWWWWXXYYYZZZZbbbaYYXWVUTSSSSSTTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=108891&chtt=Priest_Holy_Smite_AA_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z1443567653125530xtromiefeaXUVVVXYWXbbeghilnomnpsuustrqpnkkjjjjgfgfedbabbaaaaaaZXWXVVVTTTSRRRUUXYbeehhhfeghhhhhgfdaZYZWTTSUUVVUVXZabbbbbbZYabbaYXXWWUSRQSUUXXaccbbbcdddddddcbZYYXWUSTTTTTSUWXacddeedccddedcbbaZXVVUTTUVXYZZZabcddddddcbbbbZZXVUTSSRSSTVWYabddcbbbcccdccbZYXVVUSSSTUWWXXXYZaaaaaaaZZZZXWVTSSQQPPQQRSTTUUUUUUUUVVVVVVUTSSRRQQQRSTTUUUVVWWXXYYZZbcdedccbaZZZaacdefgghhhihhhhhhhhffedcaZXWVTSRSSUVWXYabaaZZaabbbbaZYWWVVUTTTUUVVWXYZbbccccbaaaaaZZZZZYWU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=9971|max=22229&chxp=1,1,45,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,4,5,10,11,12,21,48,41,87,103,133,196,249,316,373,404,466,542,523,604,619,659,616,590,530,492,420,400,317,285,204,186,136,108,86,62,43,29,21,22,10,7,3,1,1,0,1&chds=0,659&chbh=5&chxt=x&chxl=0:|min=9019|avg=9971|max=10990&chxp=0,1,48,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Holy_Smite_AA_T11_372 9971
archangel 0 0.0% 15.2 30.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.20 15.20 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
chakra 0 0.0% 10.6 44.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.60 10.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: chakra

Static Values
  • id:14751
  • school:physical
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state.
  • description:When activated, your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite will put you into a Chakra state. |CFFFFFFFFSerenity (Heal, Flash Heal, Greater Heal, Binding Heal)|R Increases the critical effect chance of your direct healing spells by $81208s1%, and causes your direct heals to refresh the duration of your Renew on the target. |CFFFFFFFFSanctuary (Prayer of Healing, Prayer of Mending)|R Increases the healing done by your area of effect spells and Renew by $81206s1% and reduces the cooldown of your Circle of Healing by $/1000;81206m2 sec. |CFFFFFFFFChastise (Smite, Mind Spike)|R Increases your total damage done by Shadow and Holy spells by $81209s1%.
darkmoon_card_volcano 57 0.6% 10.2 46.52sec 2546 0 2664 4118 4287 20.6% 15.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.19 10.19 0.00 0.00 0.0000 0.0000 25934
Direct Results Count Pct Average Min Max Total Damage
hit 6.5 63.74% 2664.04 2629 2775 17297
crit 2.1 20.59% 4117.57 4062 4287 8637
miss 1.6 15.67% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1371 13.7% 22.2 20.67sec 27901 23413 0 0 0 0.0% 15.8% 0.0% 0.0% 192 2872 4472 22.8% 0.0% 96.3%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.22 22.22 191.53 191.53 1.1917 2.2738 619934
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 84.25% 0.00 0 0 0
miss 3.5 15.75% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.8 77.19% 2871.72 2297 3457 424548
crit 43.7 22.81% 4471.69 3549 5341 195386

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
holy_fire 2806 28.1% 38.8 11.79sec 32724 27146 22794 35521 45139 22.3% 0.0% 0.0% 0.0% 360 677 1055 22.5% 0.0% 60.9%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.78 38.78 360.41 360.41 1.2055 0.7643 1268897
Direct Results Count Pct Average Min Max Total Damage
hit 30.1 77.66% 22794.36 13893 29216 686402
crit 8.7 22.34% 35520.73 21464 45139 307720
Tick Results Count Pct Average Min Max Total Damage
hit 279.4 77.52% 677.43 417 863 189269
crit 81.0 22.48% 1055.47 644 1334 85506

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.110000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.031200
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 2.0 300.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 1.2142 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1527 15.3% 27.8 16.43sec 24811 20898 0 0 0 0.0% 15.6% 0.0% 0.0% 192 3199 4980 22.6% 0.0% 96.2%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.83 27.83 191.72 191.72 1.1872 2.2692 690405
Direct Results Count Pct Average Min Max Total Damage
hit 23.5 84.37% 0.00 0 0 0
miss 4.3 15.63% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 148.4 77.41% 3198.75 2587 3862 474741
crit 43.3 22.59% 4980.09 3997 5967 215664

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3758 37.7% 83.4 5.34sec 20371 13117 18072 28174 41431 22.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
83.43 83.43 0.00 0.00 1.5530 0.0000 1699565
Direct Results Count Pct Average Min Max Total Damage
hit 64.4 77.24% 18072.01 12190 26816 1164632
crit 19.0 22.76% 28173.61 18833 41431 534932

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.$?s55692[ Damage is increased by $55692s1% if the target is afflicted by Holy Fire.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 562
melee 562 100.0% 22.2 14.83sec 9214 6806 7329 19832 24133 22.1% 6.0% 24.2% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.17 22.17 0.00 0.00 1.3538 0.0000 204293
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 47.66% 7329.47 505 9050 77454
crit 4.9 22.12% 19832.19 1346 24133 97265
glance 5.4 24.19% 5514.45 379 6787 29573
dodge 1.3 6.03% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 62.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.99 5.99 0.00 0.00 1.5301 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Holy_Smite_AA_T11_372
devouring_plague mana 15.8% 6.0 4632
holy_fire mana 15.0% 13.0 2513
shadow_word_pain mana 17.5% 6.1 4076
smite mana 51.7% 5.1 4027
Resource Gains Type Count mana Average Overflow
archangel mana 15.2 92945.4 6116.8 0.4%
blessing_of_might mana 1809.3 29420.4 16.3 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 5.0 12550.9 2510.6 0.0%
hymn_of_hope_max_mana mana 1.0 16913.4 16913.4 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.3 92853.2 51.3 0.3%
replenishment mana 1809.3 55258.6 30.5 0.2%
shadow_fiend mana 20.8 83002.9 3983.9 0.0%
spirit_intellect_regen mana 1809.3 179779.4 99.4 0.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 122.6 0.0 3.7sec 3.7sec 38% 38%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_chastise 1.0 9.4 0.0sec 45.2sec 99% 99%

Database details

  • id:81209
  • cooldown name:buff_chakra_chastise
  • tooltip:Increases the damage done by your Shadow and Holy spells by $s1%.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_pre 10.6 0.0 44.8sec 44.8sec 19% 23%

Database details

  • id:14751
  • cooldown name:buff_chakra_pre
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state.
  • max_stacks:1
  • duration:-0.00
  • cooldown:30.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.5sec 46.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 15.2 0.0 30.3sec 30.3sec 59% 59%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.1 106.1 28.8sec 3.7sec 94% 84%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 1.0 4.0 0.0sec 1.6sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.9sec 51.9sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 10.0 0.0 47.3sec 47.3sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 2.0 0.0 300.3sec 0.0sec 7% 7%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.3 0.2 120.3sec 106.7sec 5% 5%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 4.0 0.0 125.3sec 125.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 6.0 0.0 62.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 16.7%
holy_evangelism_1 10.1%
holy_evangelism_2 10.5%
holy_evangelism_3 11.2%
holy_evangelism_4 11.3%
holy_evangelism_5 40.1%

Procs

Count Interval
surge_of_light 2.5 106.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.30%
σ of the average dps 2.5402
2 * σ / μ 0.0510%
95% Confidence Intervall ( μ ± 2σ ) ( 9965.44 - 9975.60 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 9962.90 - 9978.14 )
Sample Data
σ 254.0217
Minimum 9019.40
Maximum 10989.79
Spread ( max - min ) 1970.39
Range ( max - min ) / 2 985.20
Range% 9.88
10th Percentile 9659.98
90th Percentile 10308.70
( 90th Percentile - 10th Percentile ) 648.73
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2596
0.1 scale factor error with delta=300 573
0.05 scale factor error with delta=300 2294
0.01 scale factor error with delta=300 57357
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 chakra
A archangel,if=buff.holy_evangelism.stack>=5
B holy_fire
C devouring_plague,if=remains<tick_time|!ticking
D shadow_word_pain,if=remains<tick_time|!ticking
E smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCD5EEEEAEEEEBEEEEEDBCBDAEE9EEEBE6CEDBBAEECCCDE9EBBDCCAEEEBEEEDB9CBAEEDEEEBCBDAEEBEE9ECEDB8BDAEECEBEE9BDDCBAEEEEDEEBCBDAEEEBE9EECDBBAEEEDEEB9CBDAEEBEEBDCBAEEE967BC8DDEBAEEEEEDEBCBD9AEEEBCEEDBBCAEEEDE9EBBCDDAEEBEEEEDB9CBAEDDEEBECBDBAEECE9EBD8B

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 1.40% 1.40% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 25.10% 19.14% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 0
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 2
Empowered Healing 3
Divine Fury 3
Desperate Prayer 1
Surge of Light 1
Inspiration 2
Divine Touch 2
Holy Concentration 2
Lightwell 1
Tome of Light 2
Rapid Renewal 1
Spirit of Redemption 1
Serendipity 2
Body and Soul 0
Chakra 1
Revelations 1
Blessed Resilience 0
Test of Faith 2
State of Mind 2
Circle of Healing 1
Guardian Spirit 1
Shadow Rank
Darkness 0
Improved Shadow Word: Pain 0
Veiled Shadows 1
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 0
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Holy_Smite_AA_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/chakra
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Shadow_T11_372 : 27110dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27109.7 9.75 / 0.04% 17.2 1573.0 1590.5 mana 0.00% 37.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
Glyphs
  • spirit_tap
  • inner_fire
  • psychic_scream
  • fading
  • fortitude
  • levitate
  • shadow_word_pain
  • shadow_word_death
  • mind_flay

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:81609|65301|35467|30207|25627|23329|21570|11620|7296&chds=0,163219&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++81609++devouring_plague,9482C9,0,0,15|t++65301++vampiric_touch,9482C9,1,0,15|t++35467++mind_blast_3,9482C9,2,0,15|t++30207++mind_blast_2,9482C9,3,0,15|t++25627++mind_blast_1,9482C9,4,0,15|t++23329++shadow_word_death,9482C9,5,0,15|t++21570++mind_blast_0,9482C9,6,0,15|t++11620++mind_flay,9482C9,7,0,15|t++7296++melee,9482C9,8,0,15&chtt=Priest_Shadow_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x330&cht=p&chf=bg,s,333333&chd=t:29,20,11,10,6,5,4,4,4,3,3,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B&chl=mind_flay|vampiric_touch|shadow_word_pain|devouring_plague|mind_blast_3|melee|mind_blast_2|shadow_word_death|shadowy_apparition|mind_blast_1|devouring_plague_burst|mind_blast_0|darkmoon_card_volcano&chtt=Priest_Shadow_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ckkkllmou5678420xvuupnmlkkkkjjihhhhhggfffffeeedcbbbaaaaaaZZZYYYYYXXXXXWWVVVVUUUUVVVVVVVVVWWWWWWVVWWYacfghijjjjjjjjjiihhggggffffffeedddcccccbbaaZZZYYYYXXXXXXXWWWWVVVVUUUUUUUUUUUUUUUUUUUUUUTTTUWYbcdeffggffffffffeeeddcccbbbbbbaaaaaZZZYYXXWWWWVVVVVVUUUUUUUUUUTTSSSRRRRRRRRRRRRRRRRRSSSRRSTUWYabcdddddddddddddcccbbbbbbbbbaaaaaaaaaaaaZZZZZZZZZZZZZZZZaaaaaaaaZZZZZZZZZZZZZaaaaaaabbbbcegijklllllkkkkkkkkkkjjjiiiiiijjjjjjjjjjjkkkllkkkkllllmmmmmmmmmmmmmmmllllllll&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=168339&chtt=Priest_Shadow_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uxy232121214578655320zxwssqrpqoomlkklkjiiiiiiihihhgggghhhgghhhhghggfffffffffeeeeddeeffffgggghhiiijjkkkklkkkkkkkkkjjiihhgggfffeeeeeeeeeeeefffgggghhhhhhhhhhhiiihhhgggggggggggggfggghhhijjkklllmmmmmmmmmmllllkjjiihhggggffffeeeddeeeefffffffgggghhhhhhhhhhhhhhggggggggggfffffffgghhhhhhhiijjjjkkkkkkkkkkkkjjjiihhggggfffffffffffffggghhiiiiiijjjjjjjjjjjjiiiiihhhhhhhhiiiijjjkklmmnnoopppqqqqqqqqqpppoonnmmlllkkjjjiiihhhhhhiiijjjjkkklllmmmmmmmmmllllllkkkjjjjjjjiiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27110|max=45602&chxp=1,1,59,100&chtt=Priest_Shadow_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,0,0,3,3,5,11,23,32,55,73,111,159,207,309,353,428,476,530,589,613,674,621,640,610,572,503,469,381,351,271,231,172,142,104,75,62,41,29,23,14,8,11,5,3,2,0,1,2&chds=0,674&chbh=5&chxt=x&chxl=0:|min=25242|avg=27110|max=29213&chxp=0,1,47,100&chtt=Priest_Shadow_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Shadow_T11_372 27110
archangel 0 0.0% 5.3 92.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.30 5.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
darkmoon_card_volcano 79 0.3% 10.2 46.27sec 3503 0 3086 4775 5217 24.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 35838
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 75.34% 3086.41 3023 3377 23790
crit 2.5 24.66% 4775.03 4671 5217 12047

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 4236 15.6% 20.2 22.86sec 94665 81609 0 0 0 0.0% 0.0% 0.0% 0.0% 203 4707 9898 22.6% 0.0% 99.0%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 203.43 203.43 1.1600 2.2009 1195837
Direct Results Count Pct Average Min Max Total Damage
hit 20.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 157.5 77.44% 4707.40 3527 7073 741628
crit 45.9 22.56% 9898.00 7371 14783 454209

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4786.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
devouring_plague_burst 796 2.9% 20.2 22.86sec 17782 0 14248 29960 44363 22.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 0.00 0.00 0.0000 0.0000 359779
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 77.51% 14247.70 10585 21227 223442
crit 4.6 22.49% 29960.17 22122 44363 136337

Action details: devouring_plague_burst

Static Values
  • id:0
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:7313.93
  • base_dd_max:7313.93
mind_blast_0 315 1.2% 5.7 72.41sec 25173 21570 20038 42422 61859 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_0

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.65 5.65 0.00 0.00 1.1671 0.0000 142307
Direct Results Count Pct Average Min Max Total Damage
hit 4.4 77.06% 20037.67 17287 29598 87286
crit 1.3 22.94% 42421.91 36130 61859 55021

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_1 881 3.3% 13.2 32.84sec 30193 25627 24127 50960 85225 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_1

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.20 13.20 0.00 0.00 1.1782 0.0000 398420
Direct Results Count Pct Average Min Max Total Damage
hit 10.2 77.39% 24127.36 20772 40778 246403
crit 3.0 22.61% 50959.54 43413 85225 152017

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_2 1085 4.0% 13.7 30.44sec 35676 30207 28465 60158 108591 22.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_2

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.75 13.75 0.00 0.00 1.1811 0.0000 490450
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 77.25% 28464.77 24256 51957 302270
crit 3.1 22.75% 60157.93 50695 108591 188180

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_3 1551 5.7% 16.8 25.45sec 41657 35467 33273 70331 131957 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_3

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.83 16.83 0.00 0.00 1.1745 0.0000 701089
Direct Results Count Pct Average Min Max Total Damage
hit 13.0 77.38% 33272.92 27740 63137 433303
crit 3.8 22.62% 70331.25 57977 131957 267786

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_flay 7835 28.9% 123.0 3.64sec 28803 11620 0 0 0 0.0% 0.0% 0.0% 0.0% 368 7349 15524 27.9% 0.0% 60.7%

Stats details: mind_flay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.99 122.99 367.98 367.98 2.4789 0.7453 3542488
Direct Results Count Pct Average Min Max Total Damage
hit 123.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 265.4 72.13% 7348.58 6348 11550 1950580
crit 102.5 27.87% 15523.99 13267 24139 1591907

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1647.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement speed slowed.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d and slowing their movement speed by $s2%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.257000
  • base_td:167.30
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 5.3 91.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 1.1380 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_death 1067 3.9% 17.6 6.31sec 27382 23329 21820 46029 67863 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.62 17.62 0.00 0.00 1.1738 0.0000 482342
Direct Results Count Pct Average Min Max Total Damage
hit 13.6 77.02% 21819.74 18828 32471 296048
crit 4.0 22.98% 46029.15 39351 67863 186294

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2297.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s1 Shadow damage to the target. Deals three times as much damage to targets below 25% health. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.282000
  • base_dd_min:301.52
  • base_dd_max:301.52
shadow_word_pain 4082 15.1% 1.0 391.09sec 1842532 1776607 0 0 0 0.0% 0.0% 0.0% 0.0% 202 5505 11618 22.8% 0.0% 99.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 202.14 202.14 1.0371 2.2325 1394176
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 156.1 77.23% 5505.25 4172 7893 859452
crit 46.0 22.77% 11617.68 8719 16497 534725

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowy_apparition 998 3.7% 28.8 15.38sec 15649 0 12312 25961 33601 28.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.84 27.78 0.00 0.00 0.0000 0.0000 451303
Direct Results Count Pct Average Min Max Total Damage
hit 19.8 71.20% 12312.35 11165 16077 243578
crit 8.0 28.80% 25961.19 23334 33601 207726

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you deal periodic damage with your Shadow Word: Pain, you have a chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal shadow damage. While moving, the chance to summon the shadowy apparation is increased.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.515000
  • base_dd_min:516.19
  • base_dd_max:516.19

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch 5492 20.3% 32.4 14.10sec 76668 65301 0 0 0 0.0% 0.0% 0.0% 0.0% 200 9907 20875 22.8% 0.0% 98.3%

Stats details: vampiric_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.39 32.39 200.20 200.20 1.1741 2.2193 2483219
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.6 77.23% 9906.53 6974 14725 1531689
crit 45.6 22.77% 20874.89 14575 30776 951530

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3294.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $o2 Shadow damage over $d to your target and causes up to 10 party or raid members to gain 1% of their maximum mana per 10 sec when you deal damage from Mind Blast.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.400000
  • base_td:108.70
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - shadow_fiend 1414
melee 1414 100.0% 58.6 7.05sec 9907 7296 7464 20318 26754 22.4% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.60 58.60 0.00 0.00 1.3579 0.0000 580554
Direct Results Count Pct Average Min Max Total Damage
hit 31.4 53.59% 7463.55 505 10033 234355
crit 13.1 22.43% 20318.14 1346 26754 267058
glance 14.1 23.98% 5631.03 379 7525 79141

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 15.7 27.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.71 15.71 0.00 0.00 1.5329 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Shadow_T11_372
devouring_plague mana 13.6% 19.8 4786
mind_blast_0 mana 2.8% 7.2 3500
mind_blast_1 mana 6.5% 8.6 3500
mind_blast_2 mana 6.8% 10.2 3500
mind_blast_3 mana 8.3% 11.9 3500
mind_flay mana 28.5% 17.5 1647
shadow_word_death mana 5.7% 11.9 2297
shadow_word_pain mana 0.6% 437.6 4211
vampiric_touch mana 15.0% 23.3 3294
Resource Gains Type Count mana Average Overflow
archangel mana 5.3 185895.0 35071.2 3.0%
blessing_of_might mana 1809.3 28219.3 15.6 4.3%
dispersion mana 0.0 292.2 7531.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
masochism mana 17.6 154697.4 8782.0 12.8%
mp5_regen mana 1809.3 89083.3 49.2 4.3%
replenishment mana 1809.3 53482.8 29.6 4.5%
shadow_fiend mana 58.6 201652.8 3441.3 11.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.4sec 181.4sec 7% 9%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 82.0 0.0 5.5sec 5.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_archangel 5.3 0.0 92.5sec 92.5sec 21% 23%

Database details

  • id:87153
  • cooldown name:buff_dark_archangel
  • tooltip:Damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death increased by $w1%.
  • max_stacks:1
  • duration:18.00
  • cooldown:90.00
  • default_chance:100.00%
dark_evangelism 6.3 484.7 75.9sec 0.9sec 98% 96%

Database details

  • id:81661
  • cooldown name:buff_dark_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
empowered_shadow 1.0 48.4 391.0sec 9.2sec 99% 98%

Database details

  • id:95799
  • cooldown name:buff_empowered_shadow
  • tooltip:$w1% increased periodic shadow damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
glyph_of_shadow_word_death 8.9 0.0 13.2sec 13.2sec 11% 11%

Database details

  • id:
  • cooldown name:buff_glyph_of_shadow_word_death
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.3 0.0 51.5sec 51.5sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 10.1 0.0 47.0sec 47.0sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
self_movement 8.9 0.0 13.1sec 13.1sec 5% 5%

Database details

  • id:
  • cooldown name:buff_self_movement
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_orb 44.3 58.3 10.2sec 4.4sec 58% 89%

Database details

  • id:77487
  • cooldown name:buff_shadow_orb
  • tooltip:Consumed to increase damage done by Mind Blast or Mind Spike.
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend 5.3 0.0 91.7sec 0.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.2 0.0 117.3sec 117.3sec 18% 18%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 2%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 15.7 0.0 27.5sec 0.0sec 16% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_form

Database details

  • id:
  • cooldown name:buff_shadow_form
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace

Database details

  • id:
  • cooldown name:buff_vampiric_embrace
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 4.3%
dark_evangelism_1 0.1%
dark_evangelism_2 0.8%
dark_evangelism_3 0.7%
dark_evangelism_4 2.5%
dark_evangelism_5 91.5%
holy_evangelism_0 100.0%
mind_spike_0 100.0%
shadow_orb_0 11.4%
shadow_orb_1 26.7%
shadow_orb_2 27.8%
shadow_orb_3 34.1%

Procs

Count Interval
shadowy_apparation_proc 28.8 15.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.43%
σ of the average dps 4.8773
2 * σ / μ 0.0360%
95% Confidence Intervall ( μ ± 2σ ) ( 27099.96 - 27119.47 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27095.08 - 27124.34 )
Sample Data
σ 487.7301
Minimum 25241.55
Maximum 29212.73
Spread ( max - min ) 3971.18
Range ( max - min ) / 2 1985.59
Range% 7.32
10th Percentile 26513.89
90th Percentile 27762.65
( 90th Percentile - 10th Percentile ) 1248.76
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1294
0.1 scale factor error with delta=300 2114
0.05 scale factor error with delta=300 8457
0.01 scale factor error with delta=300 211449
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 shadow_form
5 vampiric_embrace
6 snapshot_stats
7 volcanic_potion,if=!in_combat
8 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 mind_blast,if=buff.shadow_orb.stack>=1
A berserking
B shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains<gcd+0.5)&miss_react
C devouring_plague,if=(!ticking|dot.devouring_plague.remains<gcd+1.0)&miss_react
D stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains<cast_time+2.5
E vampiric_touch,if=(!ticking|dot.vampiric_touch.remains<cast_time+2.5)&miss_react
F start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
G archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
H shadow_word_death,health_percentage<=25
I shadow_fiend
J mind_blast
K mind_flay
L dispersion,moving=1
M devouring_plague,moving=1,if=mana_pct>10
N shadow_word_death,moving=1
O dispersion

Sample Sequence

013457ABC9EIKKGK9KKEK9KKCK9KEKK9KKKEJKCKK9EKKK9KKCE9KKK9KEKI9KCKE9GKKK9KEK9CKKK9EKKK9KCEKJKKK9EKK9CKKE9KKK9AIKEK9CKGKK9EKKK9KCEK9KKK9EKKK9CKEK9KKK9EIKCKJKKEK9KKKC9EGKKK9KEKK9CKKE9KKK9KEKC9KKK9EKKK9ICEKKJKAKKEJKKK9CGKKE9KKK9KECK9KKKE9FHHDKK9CKEFHHD9KKK9EFHHDKC9KKEFHHD9KKIK9ECFGHHDK9KKEFHHDJKKCK9EFHHDKK9KE8FHHDK9CKKE9FHHDKK9IKCEFHHAD9KK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 23897 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 2
Evangelism 2
Archangel 1
Inner Sanctum 2
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 0
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 2
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 3
Improved Devouring Plague 2
Twisted Faith 2
Shadowform 1
Phantasm 0
Harnessed Shadows 2
Silence 0
Vampiric Embrace 1
Masochism 2
Mind Melt 2
Pain and Suffering 2
Vampiric Touch 1
Paralysis 0
Psychic Horror 0
Sin and Punishment 2
Shadowy Apparition 3
Dispersion 1

Profile

#!./simc

priest=Priest_Shadow_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
glyphs=spirit_tap/inner_fire/psychic_scream/fading/fortitude/levitate/shadow_word_pain/shadow_word_death/mind_flay
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/shadow_form
actions+=/vampiric_embrace
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mind_blast,if=buff.shadow_orb.stack>=1
actions+=/berserking
actions+=/shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains actions+=/devouring_plague,if=(!ticking|dot.devouring_plague.remains actions+=/stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains actions+=/vampiric_touch,if=(!ticking|dot.vampiric_touch.remains actions+=/start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
actions+=/archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
actions+=/shadow_word_death,health_percentage<=25
actions+=/shadow_fiend
actions+=/mind_blast
actions+=/mind_flay
actions+=/dispersion,moving=1
actions+=/devouring_plague,moving=1,if=mana_pct>10
actions+=/shadow_word_death,moving=1
actions+=/dispersion
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Rogue_Assassination_T11_372 : 27276dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27276.3 12.04 / 0.04% 1021.9 26.7 26.5 energy 42.03% 36.3
Origin http://chardev.org/?profile=36311
Talents http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
Glyphs
  • expose_armor
  • mutilate
  • backstab
  • rupture

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27472|18271|16492|14300|10456|3223|1610&chds=0,54944&chco=336600,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E&chm=t++27472++envenom,336600,0,0,15|t++18271++garrote,C55D54,1,0,15|t++16492++mutilate,C79C6E,2,0,15|t++14300++backstab,C79C6E,3,0,15|t++10456++rupture,C55D54,4,0,15|t++3223++melee_main_hand,C79C6E,5,0,15|t++1610++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Assassination_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,14,12,10,10,9,7,6,4,2,1&chds=0,100&chco=336600,336600,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54&chl=instant_poison|envenom|melee_main_hand|deadly_poison|venomous_wound|backstab|mutilate_mh|melee_off_hand|mutilate_oh|rupture|garrote&chtt=Rogue_Assassination_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:m2681uwvstvrsrtsnklkjhedccbbbbXWXXYYZabbcbbbbbbbbbbaZZXWVVVVUUUUUUUUUUUUUUTTUUUUUUUUVVVVVVVVVVVUUVVUUUUUUUUUUUUUUUUUUUUUUUVXWVVVVWWWWWWWWWWWVVVVVVUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVUUUVVVVVWWWWWVVVVUUUUUUUUUUUUUUUTTTTTTTTUUVVWWXXXYYYYZYZYYYYYYYXYabZYXXYYYZZZZZZaZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZaaaaaaaaabbbbbbcccccdddddddddddddddddddddeeeeeeeeeeeeeeeeffillkjiiiiihhhhiiiiiiiiihhhhhgfedcddefghjklmnopqqrrrrqpponmlkjjiihhggggffffffffeeeeeeeeeee&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=102&chtt=Rogue_Assassination_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z0221233443467777421zxwuutrqponnnmmllkkkjjjiiiihggfffeeddcccbbbbbaaaaaaaaabbbbbbbbccccccccccccccccbbbbbbbaaaaaaaaaabbcccdddeefffggghhhihhhhhhhhggffffeeeedddddcccccccccccccccccccdddddddcccccccccccbbbbbaaaaaaaaaabbbccccdddeeeffffgggfffffggggggghhhhiiijjjjkkkkkkjjjjjiihhhggfffeeeddddccccccccccccccccccccccccdddddddddeeeeeeeeefffffffffffffffffeefeeeeeeeeffffgghiijjkkkllmmnnooopppoooooonnnmmmmlllllllllllllllmmmmmmmmmlllkkkjjiiihhhhggggggggfffffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27276|max=49485&chxp=1,1,55,100&chtt=Rogue_Assassination_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,4,5,5,8,16,21,42,64,75,89,130,194,195,272,340,365,456,498,475,549,581,588,623,576,541,496,485,409,341,316,245,231,192,148,103,84,65,53,36,25,17,16,8,9,1,2,4&chds=0,623&chbh=5&chxt=x&chxl=0:|min=25067|avg=27276|max=29505&chxp=0,1,50,100&chtt=Rogue_Assassination_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Assassination_T11_372 27276
backstab 2472 9.1% 76.5 2.08sec 14613 14300 8262 19706 25502 59.0% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
76.50 76.50 0.00 0.00 1.0219 0.0000 1117921
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 36.07% 8262.32 7521 10724 228012
crit 45.2 59.03% 19706.49 17886 25502 889909
dodge 3.7 4.89% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
deadly_poison 2848 10.4% 346.5 1.30sec 3718 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 8023 12397 13.1% 0.0% 99.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
346.45 1.02 149.84 149.84 0.0000 3.0000 1287972
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 130.2 86.91% 8023.20 1449 10870 1044884
crit 19.6 13.09% 12396.50 2360 16794 243088

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
envenom 3933 14.4% 63.0 7.14sec 28246 27472 20410 43364 63153 38.5% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.98 62.98 0.00 0.00 1.0282 0.0000 1778977
Direct Results Count Pct Average Min Max Total Damage
hit 35.6 56.57% 20410.14 8076 30657 727176
crit 24.3 38.51% 43364.30 19965 63153 1051801
dodge 3.1 4.92% 0.00 0 0 0

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deadly Poison application chance increased by $s3%. Instant Poison application frequency increased by $s2%.
  • description:Finishing move that consumes your Deadly Poison and deals instant poison damage. Following the Envenom attack your Deadly Poison application chance is increased by $s3%, and your Instant Poison application frequency by $s2%, for 1 sec plus an additional 1 sec per combo point. Poison doses, up to the number of combo points spent, are consumed to increase Envenom's damage: 1 point : ${$AP*0.09*$+($m1*1)} damage 2 points: Up to ${$AP*0.18*$+($m1*2)} damage 3 points: Up to ${$AP*0.27*$+($m1*3)} damage 4 points: Up to ${$AP*0.36*$+($m1*4)} damage 5 points: Up to ${$AP*0.45*$+($m1*5)} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:481.60
  • base_dd_max:481.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
garrote 159 0.6% 3.8 128.59sec 18949 18271 0 0 0 0.0% 5.0% 0.0% 0.0% 21 2613 5418 27.1% 0.0% 14.2%

Stats details: garrote

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.80 3.80 21.33 21.33 1.0371 3.0000 71969
Direct Results Count Pct Average Min Max Total Damage
hit 3.6 95.01% 0.00 0 0 0
dodge 0.2 4.99% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 15.5 72.88% 2612.65 2341 3587 40624
crit 5.8 27.12% 5418.48 4823 7389 31345

Action details: garrote

Static Values
  • id:703
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for $1330d and causing ${($m1+$AP*$*0.07)*6} damage over $d, increased by your attack power. Must be stealthed and behind the target. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.070000
  • base_td:132.78
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 6658 24.4% 673.4 0.70sec 4472 0 4175 6451 8655 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
673.36 673.36 0.00 0.00 0.0000 0.0000 3011457
Direct Results Count Pct Average Min Max Total Damage
hit 585.4 86.94% 4174.86 3736 5602 2443966
crit 88.0 13.06% 6451.40 5773 8655 567491

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3220 11.8% 461.4 0.98sec 3156 3223 2977 6167 8086 26.8% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
461.41 461.41 0.00 0.00 0.9795 0.0000 1456365
Direct Results Count Pct Average Min Max Total Damage
hit 149.3 32.36% 2976.85 2695 3925 444547
crit 123.8 26.84% 6167.48 5551 8086 763734
glance 110.8 24.02% 2238.35 2021 2944 248083
dodge 22.4 4.86% 0.00 0 0 0
miss 55.0 11.92% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1609 5.9% 592.4 0.76sec 1228 1610 1158 2399 3146 26.9% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
592.37 592.37 0.00 0.00 0.7631 0.0000 727615
Direct Results Count Pct Average Min Max Total Damage
hit 191.7 32.36% 1158.33 1048 1527 222070
crit 159.1 26.86% 2398.92 2160 3146 381645
glance 142.3 24.02% 870.85 786 1145 123900
dodge 28.7 4.85% 0.00 0 0 0
miss 70.5 11.91% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 2967 10.9% 79.5 3.65sec 16887 16492 0 0 0 0.0% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.47 79.47 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 75.6 95.12% 0.00 0 0 0
dodge 3.9 4.88% 0.00 0 0 0

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
mutilate_mh 1979 7.3% 75.6 3.84sec 11840 0 7180 17154 22115 46.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.59 75.59 0.00 0.00 0.0000 0.0000 895043
Direct Results Count Pct Average Min Max Total Damage
hit 40.3 53.28% 7180.43 6476 9300 289196
crit 35.3 46.72% 17154.06 15399 22115 605847

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
mutilate_oh 988 3.6% 75.6 3.84sec 5912 0 3585 8560 11034 46.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.59 75.59 0.00 0.00 0.0000 0.0000 446916
Direct Results Count Pct Average Min Max Total Damage
hit 40.2 53.22% 3585.40 3230 4640 144257
crit 35.4 46.78% 8559.59 7680 11034 302658

Action details: mutilate_oh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
rupture 673 2.5% 28.5 16.05sec 10687 10456 0 0 0 0.0% 4.8% 0.0% 0.0% 217 1093 2255 26.8% 0.0% 95.8%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 216.75 216.75 1.0220 2.0000 304307
Direct Results Count Pct Average Min Max Total Damage
hit 27.1 95.20% 0.00 0 0 0
dodge 1.4 4.80% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.7 73.20% 1092.55 572 1765 173348
crit 58.1 26.80% 2254.66 1178 3636 130959

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 1.0 70.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0049 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds
venomous_wound 2737 10.0% 142.9 3.14sec 8667 0 8090 12500 16875 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.85 142.85 0.00 0.00 0.0000 0.0000 1238119
Direct Results Count Pct Average Min Max Total Damage
hit 124.2 86.92% 8090.41 7280 10923 1004532
crit 18.7 13.08% 12499.78 11247 16875 233587

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.176000
  • base_dd_min:675.14
  • base_dd_max:675.14

Resources

Resource Usage Type Res% DPR RPE
Rogue_Assassination_T11_372
backstab energy 38.0% 243.6 60
envenom energy 18.3% 807.0 35
garrote energy 1.4% 421.1 45
mutilate energy 36.2% 307.0 55
rupture energy 5.9% 427.5 25
slice_and_dice energy 0.2% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 45.2 225.8 5.0 0.0%
cold_blood energy 4.1 101.9 24.8 0.7%
energy_refund energy 192.8 627.9 3.3 2.1%
energy_regen energy 1809.3 5365.1 3.0 0.6%
murderous_intent energy 72.8 2182.6 30.0 0.0%
overkill energy 299.6 292.7 1.0 2.9%
relentless_strikes energy 71.9 1798.7 25.0 0.0%
venomous_vim energy 142.9 1413.1 9.9 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cold_blood 4.1 0.0 124.7sec 124.7sec 0% 0%

Database details

  • id:
  • cooldown name:buff_cold_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:120.00
  • default_chance:100.00%
deadly_proc 341.3 0.0 1.3sec 1.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
envenom 53.9 9.0 8.3sec 7.1sec 73% 75%

Database details

  • id:
  • cooldown name:buff_envenom
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.5 7.2 38.7sec 23.3sec 39% 40%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.9 45.8sec 31.5sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overkill 3.8 0.0 128.6sec 128.6sec 17% 17%

Database details

  • id:
  • cooldown name:buff_overkill
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 1.0 345.4 323.3sec 1.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.7sec 78.7sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
slice_and_dice 1.0 59.9 98.3sec 7.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:21.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.1 0.6 50.3sec 46.2sec 8% 13%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.6sec 423.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 2.8 0.0 182.4sec 182.4sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
vendetta 4.3 0.0 120.3sec 120.3sec 28% 100%

Database details

  • id:
  • cooldown name:buff_vendetta
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.5%
poisoned 100.0%

Procs

Count Interval
combo_points 379.6 2.2sec
combo_points_wasted 17.5 24.6sec
deadly_poisons 346.5 1.3sec
ruthlessness 52.7 8.6sec
seal_fate 99.3 4.5sec
venomous_wounds 142.9 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.29%
σ of the average dps 6.0201
2 * σ / μ 0.0441%
95% Confidence Intervall ( μ ± 2σ ) ( 27264.21 - 27288.29 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27258.19 - 27294.31 )
Sample Data
σ 602.0137
Minimum 25066.88
Maximum 29505.11
Spread ( max - min ) 4438.24
Range ( max - min ) / 2 2219.12
Range% 8.14
10th Percentile 26537.83
90th Percentile 28083.63
( 90th Percentile - 10th Percentile ) 1545.79
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1948
0.1 scale factor error with delta=300 3221
0.05 scale factor error with delta=300 12886
0.01 scale factor error with delta=300 322151
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 garrote
A slice_and_dice,if=buff.slice_and_dice.down
B rupture,if=!ticking&time<6
C vendetta
D rupture,if=!ticking&buff.slice_and_dice.remains>6
E cold_blood,sync=envenom
F envenom,if=combo_points>=4&buff.envenom.down
G envenom,if=combo_points>=4&energy>90
H envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
I backstab,if=combo_points<5&target.health_pct<35
J mutilate,if=combo_points<4&target.health_pct>=35
K vanish,if=time>30&energy>50

Sample Sequence

01245689ACJBJJEFJJJGJGJJGJDJFJJFJK9DJFJJJFJGJJFJDJFJJJJJFJDJJFJJFJDJJFJJDJFJJFJCFJDJJEFJJDDJJFJJFJDJFGJJF8JDJFJFJJDJFJJJFJK9FJJDJJFJJFJDJJCFJFJJDJJEFJGGJJFJDJFJFJJFJDJJFJJDJJFJJFJDDJFJJFJDJFJFI8IFCIDIIIIFIIIDIIIEFIIIFIIK9FIDIIGIIIGIIIFIIIDIIIFIIIFIIFIIDIIFIIIFIIIFIDIIIFIIIFDIIIFIIGIIICGIIIDIIFIIIFIIIIFIIIDIIIEFI4IIFIIFIIDIIFIIF8IIIFI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 13.01% 13.01% 1333
Spell Crit 9.88% 4.88% 874
Spell Haste 16.59% 11.03% 1413
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 15656 11048 190
Melee Hit 11.10% 11.10% 1333
Melee Crit 29.90% 20.89% 874
Melee Haste 11.03% 11.03% 1413
Expertise 6.56 6.56 197
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.76% 17.76% 1749

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 3
Lethality 3
Ruthlessness 3
Quickening 2
Puncturing Wounds 3
Blackjack 0
Deadly Brew 1
Cold Blood 1
Vile Poisons 3
Deadened Nerves 0
Seal Fate 2
Murderous Intent 2
Overkill 1
Master Poisoner 1
Improved Expose Armor 0
Cut to the Chase 3
Venomous Wounds 2
Vendetta 1
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 2
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 3
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Assassination_T11_372
origin="http://chardev.org/?profile=36311"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
glyphs=expose_armor/mutilate/backstab/rupture
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/garrote
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/rupture,if=!ticking&time<6
actions+=/vendetta
actions+=/rupture,if=!ticking&buff.slice_and_dice.remains>6
actions+=/cold_blood,sync=envenom
actions+=/envenom,if=combo_points>=4&buff.envenom.down
actions+=/envenom,if=combo_points>=4&energy>90
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/backstab,if=combo_points<5&target.health_pct<35
actions+=/mutilate,if=combo_points<4&target.health_pct>=35
actions+=/vanish,if=time>30&energy>50
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=197
# gear_hit_rating=1333
# gear_crit_rating=874
# gear_haste_rating=1413
# gear_mastery_rating=1749
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Combat_T11_372 : 26801dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26800.6 11.51 / 0.04% 1009.4 26.6 26.4 energy 24.68% 45.7
Origin http://chardev.org/?profile=55921
Talents http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
Glyphs
  • expose_armor
  • slice_and_dice
  • sinister_strike
  • adrenaline_rush

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:56185|30162|23137|10567|8094|4554|3976&chds=0,112369&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++56185++killing_spree,C79C6E,0,0,15|t++30162++eviscerate,C79C6E,1,0,15|t++23137++rupture,C55D54,2,0,15|t++10567++sinister_strike,C79C6E,3,0,15|t++8094++revealing_strike,C79C6E,4,0,15|t++4554++melee_main_hand,C79C6E,5,0,15|t++3976++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Combat_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:19,17,15,14,9,8,8,4,3,2,1&chds=0,100&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,336600,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|melee_main_hand|melee_off_hand|instant_poison|main_gauche|deadly_poison|eviscerate|rupture|revealing_strike|killing_spree_mh|killing_spree_oh&chtt=Rogue_Combat_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o72wrou0yvqoomkjjjklllqrppruy012467655664yspnlhecaXWVUTTSTTTSTTTTTTTUUUUUUTTTUUUUUUUTTTTTTTTTSSSSSSSSSTTTUUVWXYZacdefghijjkkkjkjjihhgfedcaZZYXWVVUUTTSSSSSSSSSSSSTTTTTTTTTTTTTSSSSSSSTUUUUVVVVWVVWXXYZaabcdefgghiijjkkkkjjihgfedbaZYXWVVUUUTTTTTTTTTTTTUUUUUUUUUUUUTTTTTTTTSSSSSSSSSTTTUUUVWWXYZZabcdeffghhiiiiiihhggffeeddcbbaZZYXXWWVVUUUTTTTTTTTSSSSSSSSSSSSSSSSSSSSSSTUVVWWXYZZZZZaabbcddeffghhijjklllllllkjihgfedbaZYXWWVVUUTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSSSTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Rogue_Combat_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suvxyz01234566666787654210zyxwvuuuuuuutssrrrrqqponmlkkjihhgggffffffffgggghhiiijjjjjjkkkkkjjjiihhhgggffffffggghijklmnoppqrsssttsssrrqpponmmlkjiihhgggggggggghhhiiiiiiiiiihhhhhgggggggggghhhijjklmmnnoopppppqqqqqqqpppppooonnnmmmmmllllkkkkjjjiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiijjkkllmnnooppqqqqrrqqqqpppoonmmllkkjjjiiiiiiiiiiiiiihhhhhhhggggffffffgggghhhiijjkklmmnnoopppqqqqrrrrrrrrrrrqqqqqqppppooonnnmmllkkjjiiihhhggggffffffffffggggggghhhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26801|max=42327&chxp=1,1,63,100&chtt=Rogue_Combat_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,3,6,5,18,24,32,61,60,114,159,166,223,308,333,434,435,566,612,635,651,645,592,599,556,504,446,354,322,245,215,165,130,111,77,57,42,36,28,6,9,4,4,2,1,2,0,1,1&chds=0,651&chbh=5&chxt=x&chxl=0:|min=24775|avg=26801|max=29337&chxp=0,1,44,100&chtt=Rogue_Combat_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Combat_T11_372 26801
deadly_poison 2160 8.1% 187.5 2.40sec 5209 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148 6134 9479 13.5% 0.0% 98.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
187.52 2.81 148.31 148.31 0.0000 3.0000 976798
Direct Results Count Pct Average Min Max Total Damage
hit 2.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.3 86.50% 6134.36 989 9733 786964
crit 20.0 13.50% 9479.39 1528 15038 189834

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2129 7.9% 31.3 14.29sec 30736 30162 21268 43765 58658 42.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.33 31.33 0.00 0.00 1.0191 0.0000 963087
Direct Results Count Pct Average Min Max Total Damage
hit 18.1 57.91% 21267.76 13135 28475 385925
crit 13.2 42.09% 43765.17 27058 58658 577162

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 3722 13.9% 484.7 0.99sec 3473 0 3249 5020 7747 13.4% 0.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.65 484.65 0.00 0.00 0.0000 0.0000 1683195
Direct Results Count Pct Average Min Max Total Damage
hit 417.7 86.18% 3248.53 2549 5014 1356861
crit 65.0 13.41% 5019.61 3938 7747 326334
miss 2.0 0.40% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
killing_spree 913 3.4% 7.3 63.44sec 56584 56185 0 0 0 0.0% 0.0% 0.0% 0.0% 36 0 0 0.0% 0.0% 4.0%

Stats details: killing_spree

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.29 7.29 36.35 0.00 1.0071 0.5000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:energy
  • tree:combat
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every $t1 sec with both weapons until 5 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 577 2.2% 36.4 11.33sec 7177 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 5549 11484 27.4% 0.0% 0.0%

Stats details: killing_spree_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.35 0.00 0.00 36.35 0.0000 0.0000 260907
Tick Results Count Pct Average Min Max Total Damage
hit 26.4 72.57% 5548.93 3854 7367 146391
crit 10.0 27.43% 11484.48 7938 15176 114516

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 336 1.3% 36.4 11.33sec 4176 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3230 6689 27.3% 0.0% 0.0%

Stats details: killing_spree_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.35 0.00 0.00 36.35 0.0000 0.0000 151805
Tick Results Count Pct Average Min Max Total Damage
hit 26.4 72.66% 3230.26 2235 4327 85326
crit 9.9 27.34% 6689.06 4604 8913 66479

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 2475 9.2% 178.4 2.53sec 6276 0 4864 10046 15176 27.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.37 178.37 0.00 0.00 0.0000 0.0000 1119402
Direct Results Count Pct Average Min Max Total Damage
hit 129.8 72.75% 4863.64 3854 7367 631091
crit 48.6 27.25% 10045.85 7938 15176 488311

Action details: main_gauche

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 4549 17.0% 360.8 1.26sec 5702 4554 5133 10605 16163 27.2% 11.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
360.84 360.84 0.00 0.00 1.2520 0.0000 2057525
Direct Results Count Pct Average Min Max Total Damage
hit 133.1 36.88% 5133.19 4088 7846 683184
crit 98.1 27.20% 10604.94 8422 16163 1040867
glance 86.5 23.97% 3855.45 3066 5885 333474
miss 43.1 11.95% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3975 14.8% 668.9 0.68sec 2688 3976 2419 4999 7617 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
668.91 668.91 0.00 0.00 0.6759 0.0000 1797714
Direct Results Count Pct Average Min Max Total Damage
hit 246.2 36.81% 2419.20 1927 3697 595692
crit 182.1 27.22% 4999.06 3969 7617 910160
glance 160.6 24.02% 1816.83 1445 2773 291862
miss 80.0 11.95% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revealing_strike 684 2.6% 37.5 11.95sec 8262 8094 6395 13214 16836 27.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: revealing_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.46 37.46 0.00 0.00 1.0207 0.0000 309477
Direct Results Count Pct Average Min Max Total Damage
hit 27.2 72.62% 6395.23 5110 8173 173961
crit 10.3 27.38% 13214.02 10527 16836 135516

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reveals a weakness, increasing the effectiveness of the rogue's next finishing move by $s3%.
  • description:An instant strike that causes $m1% of your normal weapon damage and increases the effectiveness of your next offensive finishing move on that target by $s3% for $d. Awards 1 combo point.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 998 3.7% 19.1 23.35sec 23591 23137 0 0 0 0.0% 0.0% 0.0% 0.0% 153 2294 4742 27.1% 0.0% 67.5%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.13 19.13 152.56 152.56 1.0196 2.0000 451355
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 111.2 72.86% 2294.44 1464 3178 255044
crit 41.4 27.14% 4741.67 3015 6546 196311

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
sinister_strike 5196 19.4% 218.7 2.07sec 10743 10567 7434 17709 22617 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
218.74 218.74 0.00 0.00 1.0167 0.0000 2349976
Direct Results Count Pct Average Min Max Total Damage
hit 148.3 67.79% 7433.80 6012 9511 1102355
crit 70.5 32.21% 17709.14 14296 22617 1247621

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:39.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:200.29
  • base_dd_max:200.29
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slice_and_dice 0 0.0% 16.2 28.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.15 16.15 0.00 0.00 1.0186 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.2 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Combat_T11_372
eviscerate energy 9.1% 878.2 35
revealing_strike energy 12.5% 206.6 40
rupture energy 4.0% 943.7 25
sinister_strike energy 71.0% 275.5 39
slice_and_dice energy 3.4% 0.0 25
Resource Gains Type Count energy Average Overflow
adrenaline_rush energy 417.2 1455.7 3.5 6.9%
combat_potency energy 153.4 2238.4 14.6 2.7%
energy_regen energy 1809.3 6766.2 3.7 1.5%
relentless_strikes energy 59.2 1480.7 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.3 0.0 88.4sec 88.4sec 23% 34%

Database details

  • id:
  • cooldown name:buff_adrenaline_rush
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
berserking 3.0 0.0 180.4sec 180.4sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 173.0 0.0 2.6sec 2.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
killing_spree 7.3 0.0 63.5sec 63.5sec 3% 39%

Database details

  • id:
  • cooldown name:buff_killing_spree
  • tooltip:(null)
  • max_stacks:1
  • duration:2.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 13.4 13.7 33.7sec 16.2sec 51% 53%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.6 4.1 45.3sec 30.9sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
poison_doses 2.8 184.0 144.3sec 2.4sec 99% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.4sec 78.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
revealing_strike 37.5 0.0 12.0sec 12.0sec 14% 85%

Database details

  • id:
  • cooldown name:buff_revealing_strike
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.3 14.8 217.9sec 28.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 7.9 1.3 52.4sec 44.4sec 14% 20%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.6sec 423.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
deep_insight 41.2%
energy_cap 1.9%
moderate_insight 20.1%
shallow_insight 20.5%

Procs

Count Interval
combo_points 300.0 1.8sec
combo_points_wasted 1.3 117.7sec
deadly_poisons 187.5 2.4sec
main_gauche 178.4 2.5sec
sinister_strike_glyph 43.8 10.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.42%
σ of the average dps 5.7549
2 * σ / μ 0.0429%
95% Confidence Intervall ( μ ± 2σ ) ( 26789.13 - 26812.15 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26783.38 - 26817.91 )
Sample Data
σ 575.4872
Minimum 24775.17
Maximum 29337.41
Spread ( max - min ) 4562.25
Range ( max - min ) / 2 2281.12
Range% 8.51
10th Percentile 26089.25
90th Percentile 27560.90
( 90th Percentile - 10th Percentile ) 1471.65
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1844
0.1 scale factor error with delta=300 2943
0.05 scale factor error with delta=300 11775
0.01 scale factor error with delta=300 294387
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 kick
7 berserking
8 slice_and_dice,if=buff.slice_and_dice.down
9 slice_and_dice,if=buff.slice_and_dice.remains<2
A killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
B adrenaline_rush,if=energy<35
C eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
D rupture,if=!ticking&combo_points=5&target.time_to_die>10
E eviscerate,if=combo_points=5
F revealing_strike,if=combo_points=4&buff.revealing_strike.down
G sinister_strike,if=combo_points<5

Sample Sequence

012457G8GGGGFDGGGGEGGGCGAGG9GGBGCGGGFDGGGGFEGGGFCGGGGFDG9GGGGFEGGGGFDG9AGGGGFCGGFCGG9GGGFDGGBGGFEGGGGCGGGFCGGGGCG9GGGADGGGEGGFEGG9GGGGFDGGGGFEGGG9G7GGGDGGBGFCGGGGCGGGGFDGGGGF9GAGGGEGGGGFDGGGFCGGGGFDG9GGGFEGGGGGCG9AGGFBCGGFDGGGGFEGG9GGGGFCGGGGFDGGGFEGG9GGGGGDGAGGGFCGGGGFDG9GGGG7FEGGBGGFDG9GGGFCGGFCGGGDGGAGG9GGGGFDGGGGFCGGGFDGGGG9GGGFDGGGGEGGGBFCGGGF9GGGGGDGGGGFEGGGFCGAGGGFDGGGEGG9GGGGFDGGGG4FCGGGFDGG9GGGFEG7BGGFEG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 10.60% 10.60% 1086
Spell Crit 10.24% 5.24% 940
Spell Haste 18.83% 13.17% 1687
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20352 14362 190
Melee Hit 9.04% 9.04% 1086
Melee Crit 30.27% 21.26% 940
Melee Haste 13.17% 13.17% 1687
Expertise 26.01 26.01 781
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1057

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 2
Puncturing Wounds 0
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 2
Improved Sinister Strike 3
Precision 3
Improved Slice and Dice 2
Improved Sprint 2
Aggression 3
Improved Kick 0
Lightning Reflexes 3
Revealing Strike 1
Reinforced Leather 0
Improved Gouge 0
Combat Potency 3
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 1
Savage Combat 2
Bandit's Guile 3
Restless Blades 2
Killing Spree 1
Subtlety Rank
Nightstalker 0
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 0
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Combat_T11_372
origin="http://chardev.org/?profile=55921"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
glyphs=expose_armor/slice_and_dice/sinister_strike/adrenaline_rush
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/kick
actions+=/berserking
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
actions+=/rupture,if=!ticking&combo_points=5&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5
actions+=/revealing_strike,if=combo_points=4&buff.revealing_strike.down
actions+=/sinister_strike,if=combo_points<5
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=1086
# gear_crit_rating=940
# gear_haste_rating=1687
# gear_mastery_rating=1057
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Subtlety_T11_372 : 26686dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26685.8 9.37 / 0.04% 1202.3 22.2 22.1 energy 34.47% 46.2
Origin http://chardev.org/?profile=36352
Talents http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
Glyphs
  • expose_armor
  • backstab
  • shadow_dance
  • slice_and_dice

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:116266|34052|26104|25228|4694|2346&chds=0,232532&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++116266++rupture,C55D54,0,0,15|t++34052++ambush,C79C6E,1,0,15|t++26104++eviscerate,C79C6E,2,0,15|t++25228++backstab,C79C6E,3,0,15|t++4694++melee_main_hand,C79C6E,4,0,15|t++2346++melee_off_hand,C79C6E,5,0,15&chtt=Rogue_Subtlety_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:31,18,11,11,9,8,7,5&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,C55D54&chl=backstab|melee_main_hand|ambush|eviscerate|melee_off_hand|instant_poison|deadly_poison|rupture&chtt=Rogue_Subtlety_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:k80mtmYdWUVcifnoroejadbfbgrtrzzrlekihfhptjYdaYZXbfeXdXbmkbcfXefnuuqjcZYSSXbXdaahkfcgafedccfhfZdacggbbeZdacaeehdadadeeZdcbdccbhkrusngZWTSVWYZbbcfdebcbdcdcaccccebefeecddgdgeegfedebededfefgehinqsqnhcZWVWYYaabccdcdcecccdddededdddddeceddcdccccdcedfefeeeefgjloppmieaXWXXZZbcdddedddddccbcbcbccdccccdcdcdcddddcdddccccccdeghknoonkhdaYYYYabcddeddddcdccdcdcdcdcdccdcdcdcdceeeffffgghhhhghijkmmljgdaYXXXYZaccddeeeeeeeeeeeeeeeeeedddddddddddcccccccccccddfhjkmmljhebZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=86&chtt=Rogue_Subtlety_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:75653445543231zzwvvuutttstrqooooooqpqqqqqonmkkjjiiiigffdeeffffggghiihiiiiijjkjihhhhgggffffffeffeeddddccccccccccdddccbbcceeffggggghhhhhhijjjjjihggffffeeeddddccccccccccccdddeeeeeeffeeeffgghhhiiiiiiiiiijjjjjihhggfffffffffffffffffgggggggfffffffeeedeeefgghhhiiiiiiiijjjjjjihggffeedddcccccccccbbbbbbbccccccccccccccddeffghhhiiijjjkkllllkkjjihggfffeedddcccccccccddddeeefffggghhhhiijjjkkkkkkklllllllllkkjjiiiiiiiiiiiiiiiiiiiiiiiihhhggfffeeddddddeefggghhhhiiijkl&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26686|max=47438&chxp=1,1,56,100&chtt=Rogue_Subtlety_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,3,6,8,13,24,22,51,69,91,113,139,213,245,304,348,375,437,540,541,593,611,571,576,548,494,483,413,427,341,292,236,202,167,147,85,89,60,35,21,17,19,10,8,4,1,2,2,0,1&chds=0,611&chbh=5&chxt=x&chxl=0:|min=25145|avg=26686|max=28600&chxp=0,1,45,100&chtt=Rogue_Subtlety_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Subtlety_T11_372 26686
ambush 3012 11.3% 39.2 11.34sec 34788 34052 16701 35618 57105 95.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.16 39.16 0.00 0.00 1.0216 0.0000 1362200
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 4.29% 16701.34 14352 26120 28082
crit 37.5 95.65% 35618.37 26877 57105 1334118
dodge 0.0 0.05% 0.00 0 0 0

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target (${$m2*1.447}% plus ${$m1*$m2/100*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:367.95
  • base_dd_max:367.95
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
backstab 8198 30.7% 142.9 3.08sec 25955 25228 13170 31426 46055 70.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.87 142.87 0.00 0.00 1.0288 0.0000 3708259
Direct Results Count Pct Average Min Max Total Damage
hit 42.7 29.88% 13170.48 11839 19367 562186
crit 100.1 70.07% 31426.23 28152 46055 3146074
dodge 0.1 0.05% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
deadly_poison 1929 7.2% 167.2 2.69sec 5219 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147 5489 8477 14.7% 0.0% 97.7%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.20 3.83 147.24 147.24 0.0000 3.0000 872624
Direct Results Count Pct Average Min Max Total Damage
hit 3.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.7 85.35% 5488.72 1079 7345 689726
crit 21.6 14.65% 8476.92 1667 11348 182897

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2947 11.0% 49.8 8.93sec 26783 26104 18045 37141 52612 45.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
49.78 49.78 0.00 0.00 1.0260 0.0000 1333178
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 54.14% 18045.09 15278 25540 486312
crit 22.8 45.81% 37140.67 31472 52612 846867
dodge 0.0 0.05% 0.00 0 0 0

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 2127 8.0% 315.0 1.43sec 3053 0 2935 4534 5846 14.1% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
315.02 315.02 0.00 0.00 0.0000 0.0000 961896
Direct Results Count Pct Average Min Max Total Damage
hit 259.3 82.30% 2934.82 2781 3784 760923
crit 44.3 14.07% 4534.38 4296 5846 200973
miss 11.4 3.63% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4690 17.6% 510.2 0.89sec 4158 4694 3554 7384 10605 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
510.22 510.22 0.00 0.00 0.8858 0.0000 2121469
Direct Results Count Pct Average Min Max Total Damage
hit 131.2 25.71% 3554.42 3091 5148 466307
crit 179.7 35.22% 7383.87 6368 10605 1326998
glance 122.5 24.01% 2678.96 2319 3861 328163
dodge 0.3 0.06% 0.00 0 0 0
miss 76.5 15.00% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2345 8.8% 655.5 0.69sec 1618 2346 1383 2872 4125 35.2% 15.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
655.51 655.51 0.00 0.00 0.6897 0.0000 1060563
Direct Results Count Pct Average Min Max Total Damage
hit 168.7 25.74% 1382.59 1203 2003 233269
crit 231.0 35.24% 2872.15 2477 4125 663374
glance 157.3 23.99% 1042.22 902 1502 163920
dodge 0.4 0.06% 0.00 0 0 0
miss 98.2 14.98% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recuperate 0 0.0% 14.9 30.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recuperate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.87 14.87 0.00 0.00 1.0191 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: recuperate

Static Values
  • id:73651
  • school:physical
  • resource:energy
  • tree:combat
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Recovering $w1 health every $t1 sec.$?$w3!=0[ Damage taken reduced by $w3%.][]
  • description:Finishing move that consumes combo points on any nearby target to restore $?s79008[4]?s79007[3.5][3]% of maximum health every $t1 sec. Lasts longer per combo point: 1 point : 6 seconds 2 points: 12 seconds 3 points: 18 seconds 4 points: 24 seconds 5 points: 30 seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3.00
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rupture 1438 5.4% 5.5 87.21sec 118371 116266 0 0 0 0.0% 0.1% 0.0% 0.0% 220 2156 4452 35.1% 0.0% 97.1%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.49 5.49 219.56 219.56 1.0181 2.0000 650246
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 99.94% 0.00 0 0 0
dodge 0.0 0.06% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 142.5 64.90% 2155.55 2058 2750 307166
crit 77.1 35.10% 4452.17 4238 5665 343080

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 17.3 26.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.32 17.32 0.00 0.00 1.0241 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 17.3 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Subtlety_T11_372
ambush energy 15.6% 869.7 40
backstab energy 56.9% 648.9 40
eviscerate energy 17.4% 765.2 35
recuperate energy 4.4% 0.0 30
rupture energy 1.4% 4734.8 25
slice_and_dice energy 4.3% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 100.1 500.5 5.0 0.0%
energy_refund energy 175.5 3.9 0.0 0.0%
energy_regen energy 1809.3 5572.8 3.1 0.0%
recuperate energy 143.2 1717.9 12.0 0.0%
relentless_strikes energy 87.4 2185.8 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 142.6 0.0 3.1sec 3.1sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
find_weakness 11.7 27.4 40.0sec 11.4sec 37% 100%

Database details

  • id:
  • cooldown name:buff_find_weakness
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.0 8.1 37.1sec 21.6sec 41% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.7 46.7sec 32.5sec 29% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.7 0.0 83.3sec 83.3sec 7% 100%

Database details

  • id:
  • cooldown name:buff_master_of_subtlety
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 3.8 157.3 111.9sec 2.8sec 98% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.8sec 78.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
recuperate 6.7 8.2 70.4sec 31.0sec 95% 95%

Database details

  • id:
  • cooldown name:buff_recuperate
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_dance 7.6 0.0 63.2sec 63.2sec 13% 13%

Database details

  • id:
  • cooldown name:buff_shadow_dance
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
shadowstep 7.6 0.0 63.6sec 63.6sec 0% 100%

Database details

  • id:
  • cooldown name:buff_shadowstep
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 8.5 8.8 53.5sec 26.8sec 97% 99%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.8 1.1 46.8sec 41.2sec 11% 17%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.5sec 423.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 4.7 0.0 98.6sec 98.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points 486.2 1.2sec
combo_points_wasted 46.6 13.7sec
deadly_poisons 167.2 2.7sec
hat_donor 303.3 1.5sec
honor_among_thieves 205.2 2.2sec
serrated_blades 49.8 8.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.94%
σ of the average dps 4.6839
2 * σ / μ 0.0351%
95% Confidence Intervall ( μ ± 2σ ) ( 26676.40 - 26695.14 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26671.72 - 26699.82 )
Sample Data
σ 468.3860
Minimum 25144.75
Maximum 28599.60
Spread ( max - min ) 3454.86
Range ( max - min ) / 2 1727.43
Range% 6.47
10th Percentile 26111.69
90th Percentile 27318.61
( 90th Percentile - 10th Percentile ) 1206.91
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1232
0.1 scale factor error with delta=300 1950
0.05 scale factor error with delta=300 7800
0.01 scale factor error with delta=300 195009
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 pool_energy,for_next=1
A shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
B pool_energy,for_next=1
C vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
D shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
E premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
F ambush,if=combo_points<=4
G preparation,if=cooldown.vanish.remains>60
H slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
I rupture,if=combo_points=5&!ticking
J recuperate,if=combo_points=5&remains<3
K eviscerate,if=combo_points=5&dot.rupture.remains>1
L backstab,if=combo_points<3&energy>60
M backstab,if=cooldown.honor_among_thieves.remains>1.75
N backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0

Sample Sequence

0124568DEFHAFFIFFJFFKLNKLLMKMMHCEFGKLLMKMMJCFMKLMKMMHLMK99ADEFKFFJFKMMKLMMHMMKLMMKMMJLLKLMMHLMKLMK9999ADEFJFFKFKLMHLMMKLMKMMJLMMKLMHLLKLL8MKMM9J999ADEFKFFHFKLLKLMMKLLJCEFHLMKLLKLLMKLMKLMMHM9999999999ADFJEFIFFKMMKMMHLMMKLMJMMKLLHLMMKLMKLL999J9ADEFKFFKFHLLKLMMKMMJMMHLMMIL8LKLMMKBBCEFGKLL9HADFFJFKFKLMMKLMKLLHCEFJLMMILMKLLKLMMHLMK99999ADEFJFFKFFKMMHLLKLMMKMMJLLKLMMHMMKLLKLM9999999JADEFKFFHFKL4LKLMMKLMJLLH8LLMIL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 8637 6944 4879
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.38% 9.38% 961
Spell Crit 11.43% 6.43% 1152
Spell Haste 20.59% 14.84% 1901
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20143 14341 190
Melee Hit 8.00% 8.00% 961
Melee Crit 37.73% 27.51% 1152
Melee Haste 14.84% 14.84% 1901
Expertise 25.78 25.78 774
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 29.69% 23.83% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.50% 11.50% 628

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 0
Puncturing Wounds 3
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 0
Improved Ambush 3
Relentless Strikes 3
Elusiveness 1
Waylay 0
Opportunity 3
Initiative 2
Energetic Recovery 3
Find Weakness 2
Hemorrhage 1
Honor Among Thieves 3
Premeditation 1
Enveloping Shadows 0
Cheat Death 0
Preparation 1
Sanguinary Vein 2
Slaughter from the Shadows 3
Serrated Blades 2
Shadow Dance 1

Profile

#!./simc

rogue=Rogue_Subtlety_T11_372
origin="http://chardev.org/?profile=36352"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
glyphs=expose_armor/backstab/shadow_dance/slice_and_dice
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/pool_energy,for_next=1
actions+=/shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
actions+=/pool_energy,for_next=1
actions+=/vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
actions+=/shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=4
actions+=/preparation,if=cooldown.vanish.remains>60
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&!ticking
actions+=/recuperate,if=combo_points=5&remains<3
actions+=/eviscerate,if=combo_points=5&dot.rupture.remains>1
actions+=/backstab,if=combo_points<3&energy>60
actions+=/backstab,if=cooldown.honor_among_thieves.remains>1.75
actions+=/backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4879
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=774
# gear_hit_rating=961
# gear_crit_rating=1152
# gear_haste_rating=1901
# gear_mastery_rating=628
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# These values represent the avg HAT donor interval of the raid. # A negative value will make the Rogue use a programmed default interval. # A zero value will disable virtual HAT procs and assume a real raid is being simulated. virtual_hat_interval=-1 # A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Shaman_Elemental_T11_372 : 26673dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26672.9 11.70 / 0.04% 22.0 1211.4 1225.1 mana 0.00% 47.0
Origin http://chardev.org/?profile=14385
Talents http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
Glyphs
  • chain_lightning
  • thunder
  • healing_stream_totem
  • thunderstorm
  • astral_recall
  • renewed_life
  • flame_shock
  • lightning_bolt
  • lava_burst

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:39850|31173|13588|7501|5092|3563|625|126&chds=0,79699&chco=C41F3B,C41F3B,336600,336600,C41F3B,C41F3B,C79C6E,C41F3B&chm=t++39850++flame_shock,C41F3B,0,0,15|t++31173++lava_burst,C41F3B,1,0,15|t++13588++lightning_bolt,336600,2,0,15|t++7501++earth_shock,336600,3,0,15|t++5092++fire_nova,C41F3B,4,0,15|t++3563++fire_melee,C41F3B,5,0,15|t++625++earth_melee,C79C6E,6,0,15|t++126++fire_shield,C41F3B,7,0,15&chtt=Shaman_Elemental_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x340&cht=p&chf=bg,s,333333&chd=t:35,19,10,9,7,7,6,2,2,1,1,0,0,0&chds=0,100&chco=336600,C41F3B,336600,336600,C41F3B,C41F3B,C41F3B,336600,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C41F3B&chl=lightning_bolt|lava_burst|lightning_bolt_overload|fulmination|flame_shock|searing_totem|lava_burst_overload|earth_shock|fire_melee|fire_nova|earth_melee|fire_blast|darkmoon_card_volcano|fire_shield&chtt=Shaman_Elemental_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:q32zyyyyz01223344556545544444444444455555555555555555566667777666666655555555554444555555555555556666677777776666666655555555554444444444555555566667777777777766666555555555555555554444444445555666677777766666655555555555555555555555555556666666666666666666666555555555555555555555555556666666666666666666665555555555555555555555556666666666666666666666666665555555544444445555555666667777666666666655555555555555555555555555555555555566666666655555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117050&chtt=Shaman_Elemental_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwy1122222464577865421zywuutssrqqqppppqponmnmmmmnmmllmllmllmmnnonnonnnnnopoopppponnonnonoonnnmmmmmmmllmmlmmmmlkkkkjjjihhhhhgggfffffffgghijklmnoppqqqrrrrrrrrqpoonmllkkjjiihhhgggffggghhhiiiiijjjkkkklkkkjjiiihhhhhhhiiijjkkllmnnnooooooooonnmmlllkkkkjjjjjiihhhhhhhhgggggffffffgggghhhhhhhiijjkklllmmnnnnnnnnnnnmmllkjjiihhhhhhggghhhhiiiiijjjjjjjjjjjjjiiiiiiiiiiiihhhiiijjkkllmnnoppqqrrrrrrqqppoonmllkjjiihhhgggggggggggggfffffffffffgggghhhhhiijjjkklllllllllmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26673|max=42529&chxp=1,1,63,100&chtt=Shaman_Elemental_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,6,11,9,17,38,52,65,112,150,176,217,279,345,407,424,515,556,596,635,600,595,553,552,504,463,404,350,290,240,208,139,131,89,85,54,44,24,19,14,10,9,4,3,0,0,1,0,0,1&chds=0,635&chbh=5&chxt=x&chxl=0:|min=24833|avg=26673|max=29298&chxp=0,1,41,100&chtt=Shaman_Elemental_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Elemental_T11_372 26673
darkmoon_card_volcano 70 0.3% 10.1 47.05sec 3135 0 2723 4211 4516 27.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.07 10.07 0.00 0.00 0.0000 0.0000 31576
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.31% 2723.23 2694 2923 19834
crit 2.8 27.69% 4210.84 4162 4516 11742

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
earth_shock 598 2.2% 30.4 14.57sec 8880 7501 6933 14568 20686 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.43 30.43 0.00 0.00 1.1838 0.0000 270261
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.49% 6932.89 5948 9898 157178
crit 7.8 25.51% 14567.78 12432 20686 113082

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
elemental_mastery 0 0.0% 6.6 74.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_mastery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.63 6.63 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.6 100.00% 0.00 0 0 0

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:mana
  • tree:elemental
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Cast time of your next Lightning Bolt, Chain Lightning or Lava Burst spell is reduced by $s1%.
  • description:When activated, your next Lightning Bolt, Chain Lightning or Lava Burst spell becomes an instant cast spell. In addition, your Fire, Frost, and Nature damage is increased by $64701s2%$?s55452[, you take $55452s1% less damage from all sources,][] and you gain $64701s1% spell haste for $64701d.
flame_shock 1835 6.9% 17.7 26.24sec 46785 39850 3854 8091 10516 35.5% 0.0% 0.0% 0.0% 202 2614 5487 35.6% 0.0% 99.6%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.74 17.74 202.10 202.10 1.1740 2.2281 829757
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 64.55% 3854.41 3316 5031 44125
crit 6.3 35.45% 8090.78 6930 10516 50870
Tick Results Count Pct Average Min Max Total Damage
hit 130.2 64.44% 2613.95 2226 3429 340441
crit 71.9 35.56% 5487.42 4653 7167 394321

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:9
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 2369 8.9% 30.4 14.57sec 35197 0 27496 57819 87855 25.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.43 30.43 0.00 0.00 0.0000 0.0000 1071171
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.61% 27496.36 16522 42036 624313
crit 7.7 25.39% 57818.69 34530 87855 446857

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
lava_burst 5107 19.1% 61.5 7.39sec 37527 31173 0 37629 54380 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.53 61.36 0.00 0.00 1.2038 0.0000 2308833
Direct Results Count Pct Average Min Max Total Damage
crit 61.4 100.00% 37628.88 32364 54380 2308833

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.828000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_burst_overload 1517 5.7% 25.3 17.58sec 27069 0 12252 27177 37607 99.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.33 25.26 0.00 0.00 0.0000 0.0000 685642
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 0.25% 12251.94 11086 15411 769
crit 25.2 99.75% 27177.39 22381 37607 684873

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.622000
  • base_dd_min:1047.17
  • base_dd_max:1335.47
lightning_bolt 9408 35.3% 219.8 2.04sec 19348 13588 15127 31876 46051 25.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
219.84 219.14 0.00 0.00 1.4240 0.0000 4253555
Direct Results Count Pct Average Min Max Total Damage
hit 163.1 74.43% 15127.32 12808 22034 2467245
crit 56.0 25.57% 31876.25 26769 46051 1786310

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.914000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_bolt_overload 2790 10.5% 90.4 4.92sec 13958 0 10914 22992 33307 25.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.38 90.09 0.00 0.00 0.0000 0.0000 1261450
Direct Results Count Pct Average Min Max Total Damage
hit 67.0 74.43% 10913.99 9264 15936 731754
crit 23.0 25.57% 22992.38 19361 33307 529696

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.686000
  • base_dd_min:539.17
  • base_dd_max:615.99
searing_totem 1821 6.8% 6.0 60.34sec 138302 137538 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3189 6704 25.5% 0.0% 71.3%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 201.57 201.57 1.0056 1.6000 823272
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.2 74.53% 3189.35 2741 4281 479167
crit 51.3 25.47% 6703.60 5729 8947 344105

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - fire_elemental 3696
fire_blast 433 11.7% 12.0 9.86sec 4408 0 4277 8564 9333 3.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 52898
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.93% 4276.66 3822 4667 49746
crit 0.4 3.07% 8564.15 7645 9333 3152

Action details: fire_blast

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:302.1
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:276.00
  • base_dd_max:321.00
fire_melee 2136 57.8% 23.0 4.93sec 11337 3563 11998 41882 45890 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 3.1818 0.0000 260747
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 75.83% 11998.44 10699 13111 209256
crit 0.0 0.20% 41881.70 37447 45890 1889
glance 5.5 23.98% 8994.59 8024 9834 49602

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.135000
  • base_dd_min:427.00
  • base_dd_max:460.00
fire_nova 1001 27.1% 12.0 9.86sec 10184 5092 9895 19802 21608 2.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 2.0000 0.0000 122211
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 97.08% 9895.16 8836 10804 115277
crit 0.4 2.92% 19802.07 17672 21608 6935

Action details: fire_nova

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:233.8
  • cooldown:7.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:583.00
  • base_dd_max:663.00
fire_shield 127 3.4% 40.9 3.00sec 378 126 367 732 830 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.92 40.92 0.00 0.00 3.0000 0.0000 15461
Direct Results Count Pct Average Min Max Total Damage
hit 39.7 97.00% 366.90 0 415 14563
crit 1.2 3.00% 731.62 0 830 898

Action details: fire_shield

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.032000
  • base_dd_min:89.00
  • base_dd_max:89.00
pet - earth_elemental 587
earth_melee 587 100.0% 58.0 2.00sec 1249 625 1288 2575 2660 3.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 2.0000 0.0000 72451
Direct Results Count Pct Average Min Max Total Damage
hit 42.4 73.09% 1287.93 1144 1330 54598
crit 1.7 2.97% 2574.65 2288 2660 4442
glance 13.9 23.94% 966.02 858 997 13411

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Elemental_T11_372
bloodlust mana 0.0% 0.0 1
earth_elemental_totem mana 1.0% 0.0 5623
earth_shock mana 16.8% 2.9 3016
fire_elemental_totem mana 1.0% 0.0 5388
flame_shock mana 9.7% 15.6 2995
lava_burst mana 20.4% 20.7 1817
lightning_bolt mana 40.5% 19.2 1010
searing_totem mana 1.3% 118.1 1171
pet - fire_elemental
fire_blast mana 56.4% 14.6 302
fire_nova mana 43.6% 43.7 233
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 26907.9 14.9 8.8%
flask mana 1.0 5700.0 5700.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 106835.0 106835.0 0.0%
mp5_regen mana 1809.3 96896.0 53.6 8.5%
replenishment mana 1809.3 51102.7 28.2 8.1%
rolling_thunder mana 185.6 371939.5 2003.5 18.6%
pet - fire_elemental mana
initial_mana none 1.0 47498.0 47498.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.1sec 47.1sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
elemental_focus 85.3 54.2 5.3sec 3.2sec 68% 68%

Database details

  • id:16246
  • cooldown name:buff_elemental_focus
  • tooltip:Your next $n damage or healing spells have their mana cost reduced by $s1%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 6.6 0.0 74.1sec 74.1sec 22% 24%

Database details

  • id:64701
  • cooldown name:buff_elemental_mastery
  • tooltip:Fire, Frost, and Nature damage increased by $s2%. Casting speed of all spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.6sec 48.6sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 113.1sec 113.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 1.0 0.0 338.9sec 338.9sec 4% 4%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
fire_elemental-casting 1.0 51.9 0.0sec 2.3sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:9
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
fulmination_4 2.8 97.8sec
fulmination_5 2.6 101.6sec
fulmination_6 25.0 17.8sec
lava_surge 40.4 11.0sec
rolling_thunder 185.6 2.4sec
wasted_lightning_shield 8.7 44.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.79%
σ of the average dps 5.8479
2 * σ / μ 0.0438%
95% Confidence Intervall ( μ ± 2σ ) ( 26661.19 - 26684.58 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26655.34 - 26690.43 )
Sample Data
σ 584.7894
Minimum 24833.27
Maximum 29297.83
Spread ( max - min ) 4464.56
Range ( max - min ) / 2 2232.28
Range% 8.37
10th Percentile 25951.29
90th Percentile 27448.46
( 90th Percentile - 10th Percentile ) 1497.17
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1922
0.1 scale factor error with delta=300 3039
0.05 scale factor error with delta=300 12159
0.01 scale factor error with delta=300 303981
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 flametongue_weapon,weapon=main
3 lightning_shield
4 mana_spring_totem
5 wrath_of_air_totem
6 snapshot_stats
7 volcanic_potion,if=!in_combat|buff.bloodlust.react
8 wind_shear
9 bloodlust,health_percentage<=25
A bloodlust,if=target.time_to_die<=60
B berserking
C elemental_mastery
D unleash_elements,moving=1
E flame_shock,if=!ticking|ticks_remain<3
F lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
G earth_shock,if=buff.lightning_shield.stack=9
H earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
I fire_elemental_totem
J earth_elemental_totem
K searing_totem
L spiritwalkers_grace,moving=1
M chain_lightning,if=target.adds>2
N lightning_bolt
O thunderstorm

Sample Sequence

01237ABCEFFIJNNNNNNFNNGFNNNFNNNENNNFNNNNGNNFNNGNNFNENNFNNNNGNFNNNCFNGNNNNEFNFNNNGNNFNNFNNFNENNFGNNNNNFNNNNGKFNENNNNFNNGNNCNFNNNFHNNNNEFNNGFNNNNNFFNNNBNENFKNGNFNNFNNNNGFNNENNFNNNGNCNFNNNFNHNNNFENNFGNNNKNFNNFGNNNEFNNNFNNNGNFNNNHNFNEFNNNNCNNFGNNNFKNNNNENFNNNGFNNNNFNNFNENNNFGNFNNNFNNNNHBFNNNEKNNCFNNNNFNGNNFNNNHNNNEFNNNNNNFGNNNFNNENNNFNNGKFNNNNGNFNENCNNNFNNNNNFGNFNNNNEFNNNGNNFNNNNNNFHKNNENFNNNFNNNGNNFNCHNNNNEFNNNGNNNFNNNGBNFNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 736 152 20
Agility 683 102 20
Stamina 7631 6009 5861
Intellect 6097 5314 4926
Spirit 983 983 826
Health 143601 120963 0
Mana 113885 102860 0
Spell Power 10276 7511 2207
Spell Hit 17.03% 17.03% 919
Spell Crit 21.32% 15.11% 309
Spell Haste 19.90% 14.19% 1817
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 2436 466 0
Melee Hit 7.65% 7.65% 919
Melee Crit 14.75% 7.96% 309
Melee Haste 14.19% 14.19% 1817
Expertise 0.00 0.00 0
Armor 19472 15396 15396
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.92% 2.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 18.23% 18.23% 1834

Gear

Encoded
head headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
tabard empty

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 3
Call of Flame 2
Elemental Warding 0
Reverberation 2
Elemental Precision 3
Rolling Thunder 2
Elemental Focus 1
Elemental Reach 2
Elemental Oath 2
Lava Flows 3
Fulmination 1
Elemental Mastery 1
Earth's Grasp 0
Totemic Wrath 1
Feedback 3
Lava Surge 2
Earthquake 1
Enhancement Rank
Elemental Weapons 2
Focused Strikes 0
Improved Shields 3
Elemental Devastation 0
Flurry 0
Ancestral Swiftness 2
Totemic Reach 2
Toughness 0
Stormstrike 0
Static Shock 0
Frozen Power 0
Seasoned Winds 0
Searing Flames 0
Earthen Power 0
Shamanistic Rage 0
Unleashed Rage 0
Maelstrom Weapon 0
Improved Lava Lash 0
Feral Spirit 0
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Elemental_T11_372
origin="http://chardev.org/?profile=14385"
level=85
race=troll
role=spell
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3032023212231101321203002200000000000000000000000000000000
glyphs=chain_lightning/thunder/healing_stream_totem/thunderstorm/astral_recall/renewed_life/flame_shock/lightning_bolt/lava_burst
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/flametongue_weapon,weapon=main
actions+=/lightning_shield
actions+=/mana_spring_totem
actions+=/wrath_of_air_totem
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat|buff.bloodlust.react
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/berserking
actions+=/elemental_mastery
actions+=/unleash_elements,moving=1
actions+=/flame_shock,if=!ticking|ticks_remain<3
actions+=/lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
actions+=/earth_shock,if=buff.lightning_shield.stack=9
actions+=/earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains actions+=/fire_elemental_totem
actions+=/earth_elemental_totem
actions+=/searing_totem
actions+=/spiritwalkers_grace,moving=1
actions+=/chain_lightning,if=target.adds>2
actions+=/lightning_bolt
actions+=/thunderstorm
head=headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders=shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
chest=circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist=lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs=kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet=boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists=chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands=gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5861
# gear_intellect=4926
# gear_spirit=826
# gear_spell_power=2207
# gear_hit_rating=919
# gear_crit_rating=309
# gear_haste_rating=1817
# gear_mastery_rating=1834
# gear_armor=15396
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Shaman_Enh_T11_372 : 26231dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26231.0 10.67 / 0.04% 29.5 890.2 887.4 mana 5.35% 42.9
Origin http://chardev.org/?profile=39863
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:23770|18856|14813|9890|8525|3262|2948|1470|652&chds=0,47540&chco=C41F3B,C41F3B,336600,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23770++lava_lash,C41F3B,0,0,15|t++18856++flame_shock,C41F3B,1,0,15|t++14813++lightning_bolt,336600,2,0,15|t++9890++stormstrike,C79C6E,3,0,15|t++8525++earth_shock,336600,4,0,15|t++3262++wolf_melee,C79C6E,5,0,15|t++2948++melee_main_hand,C79C6E,6,0,15|t++1470++melee_off_hand,C79C6E,7,0,15|t++652++earth_melee,C79C6E,8,0,15&chtt=Shaman_Enh_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:13,11,11,10,10,8,6,5,4,4,4,3,3,3,2,2,2,1&chds=0,100&chco=C41F3B,C79C6E,336600,C79C6E,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,336600,336600,C79C6E,C41F3B,C41F3B,336600,C79C6E,C79C6E,C79C6E&chl=lava_lash|melee_main_hand|lightning_bolt|windfury_mh|searing_totem|flametongue_oh|melee_off_hand|flame_shock|stormstrike_mh|darkmoon_card_hurricane|earth_shock|wolf_melee|searing_flames|unleash_flame|lightning_shield|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777676644455444455556655556665566666666666665555666666665566555666666666665555555666666655555556666666666655555556666666666566666666666666655555666666665555565666666666665555555666666666666666666666666665555556666666665555666666666666655666666666666666555566666666666555555666666666555556666666666666666666666666666555666666666666655555566666666655555566666666666655555566666666655555666666666555555555556665555555556666666666655555555555555555555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=25114&chtt=Shaman_Enh_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y45554455557777654544522123210zyxwwvvvuuuuuttsrqppppooopppqqqqppooooooppqqqqqqqqqppppooppqqqqqqppppoopppqqqqqqpqpppppppqqrsstttssttttttuuvvvvvvvuutttsssssssssrrqqppppppppppppppoooonnnnooopppppoooooooooppppppppoooooooooopppppoooonnnooopppqqqqqqqqqrrrsttuuutttttttttuuuuuuuuuttsssrrrrrrrrqqppooooooooooopppooooooooooopppppoooooooooopppppppoooooooooooooooooooooopppqqqrrrrrssssssssttttttttttttttttttttttsssrrrqqqpppppppooooonnooooooooppooooooooooooooooooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26231|max=36184&chxp=1,1,72,100&chtt=Shaman_Enh_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,2,3,4,1,12,21,21,43,61,83,117,146,180,245,272,360,448,485,511,548,604,617,637,651,564,560,515,470,375,327,264,216,168,125,105,77,46,42,23,14,16,12,3,2,0,1,1&chds=0,651&chbh=5&chxt=x&chxl=0:|min=24105|avg=26231|max=28321&chxp=0,1,50,100&chtt=Shaman_Enh_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372 26231
darkmoon_card_hurricane 969 3.7% 38.3 12.09sec 11435 0 7954 16385 16385 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.31 38.31 0.00 0.00 0.0000 0.0000 438057
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 58.71% 7953.66 7954 7954 178878
crit 15.8 41.29% 16384.54 16385 16385 259179

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 925 3.5% 36.7 12.18sec 11405 8525 8812 13614 17108 54.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.67 36.67 0.00 0.00 1.3379 0.0000 418199
Direct Results Count Pct Average Min Max Total Damage
hit 16.8 45.73% 8812.40 8337 11073 147759
crit 19.9 54.18% 13613.82 12880 17108 270440
miss 0.0 0.09% 0.00 0 0 0

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
fire_nova 0 0.0% 56.7 7.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
56.65 0.00 0.00 0.00 1.3348 0.0000 0

Action details: fire_nova

Static Values
  • id:1535
  • school:fire
  • resource:mana
  • tree:elemental
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5154.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites your Flame Shock spell on any nearby enemies, causing each of them to emit a wave of flames that deals $8349s2 Fire damage to every other enemy within $8349A2 yards.
flame_shock 1291 4.9% 23.1 19.82sec 25245 18856 5869 9064 12271 19.2% 0.1% 0.0% 0.0% 155 2529 3907 19.3% 0.0% 90.7%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.12 23.12 155.20 155.20 1.3389 2.6428 583580
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 80.71% 5868.84 4647 7942 109491
crit 4.4 19.20% 9064.11 7180 12271 40232
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.2 80.67% 2529.17 1992 3481 316661
crit 30.0 19.33% 3907.05 3078 5377 117196

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 2198 8.4% 339.4 1.33sec 2928 0 2651 4097 5174 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
339.39 339.39 0.00 0.00 0.0000 0.0000 993751
Direct Results Count Pct Average Min Max Total Damage
hit 273.6 80.60% 2651.48 2495 3349 725337
crit 65.5 19.30% 4096.85 3855 5174 268414
miss 0.3 0.09% 0.00 0 0 0

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_lash 3383 12.9% 42.6 10.72sec 35922 23770 24986 51570 63098 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.59 42.59 0.00 0.00 1.5113 0.0000 1529982
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 58.68% 24986.11 18292 30630 624443
crit 17.6 41.23% 51570.07 37682 63098 905540
dodge 0.0 0.09% 0.00 0 0 0

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 2841 10.8% 65.0 6.92sec 19769 14813 14699 22667 29138 63.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
64.99 64.97 0.00 0.00 1.3345 0.0000 1284691
Direct Results Count Pct Average Min Max Total Damage
hit 23.4 36.04% 14699.38 13799 18860 344180
crit 41.5 63.87% 22667.01 21319 29138 940511
miss 0.1 0.09% 0.00 0 0 0

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 620 2.4% 40.8 11.16sec 6880 0 5464 8420 10738 52.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.76 40.76 0.00 0.00 0.0000 0.0000 280460
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 44.85% 5463.63 5130 6950 99885
crit 21.4 52.61% 8420.25 7926 10738 180575
miss 0.0 0.09% 0.00 0 0 0
none 1.0 2.45% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2911 11.1% 287.1 1.58sec 4585 2948 3498 7212 8743 41.3% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
287.13 287.13 0.00 0.00 1.5553 0.0000 1316528
Direct Results Count Pct Average Min Max Total Damage
hit 79.9 27.83% 3498.37 3338 4244 279593
crit 118.7 41.35% 7212.06 6876 8743 856192
glance 68.9 23.98% 2624.82 2503 3183 180743
dodge 0.2 0.09% 0.00 0 0 0
miss 19.4 6.75% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1452 5.5% 286.4 1.58sec 2292 1470 1749 3606 4371 41.3% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
286.41 286.41 0.00 0.00 1.5589 0.0000 656419
Direct Results Count Pct Average Min Max Total Damage
hit 79.8 27.87% 1749.00 1669 2122 139590
crit 118.3 41.31% 3605.72 3438 4371 426639
glance 68.7 24.00% 1312.30 1252 1592 90190
dodge 0.2 0.08% 0.00 0 0 0
miss 19.3 6.74% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 792 3.0% 279.0 1.62sec 1284 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121 2743 4238 14.4% 0.0% 80.4%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.02 279.02 121.12 121.12 0.0000 3.0000 358321
Direct Results Count Pct Average Min Max Total Damage
hit 279.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 103.7 85.61% 2743.37 716 4945 284469
crit 17.4 14.39% 4237.73 1106 7640 73851

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:795.11
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 2599 9.9% 8.1 59.88sec 145673 143901 0 0 0 0.0% 0.0% 0.0% 0.0% 279 3810 5887 19.4% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.07 8.07 279.28 279.02 1.0123 1.6000 1175129
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 225.0 80.64% 3809.65 3578 4944 857208
crit 54.0 19.36% 5886.58 5528 7639 317921

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 123.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.16 4.16 0.00 0.00 1.2908 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1525 5.8% 46.2 9.78sec 14921 9890 0 0 0 0.0% 0.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.22 46.22 0.00 0.00 1.5087 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 45.8 99.15% 0.00 0 0 0
dodge 0.4 0.85% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 1016 3.9% 45.8 9.86sec 10030 0 6972 14368 17431 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.82 45.82 0.00 0.00 0.0000 0.0000 459602
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 58.66% 6971.70 6655 8462 187396
crit 18.9 41.34% 14368.34 13709 17431 272207

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 509 1.9% 45.8 9.86sec 5019 0 3491 7197 8716 41.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.82 45.82 0.00 0.00 0.0000 0.0000 229984
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 58.78% 3491.36 3327 4231 94042
crit 18.9 41.22% 7197.02 6855 8716 135942

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.5 16.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 1.3330 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 664 2.5% 28.5 16.08sec 10547 0 9551 14761 18328 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 0.0000 0.0000 300316
Direct Results Count Pct Average Min Max Total Damage
hit 23.0 80.63% 9551.21 9046 11934 219268
crit 5.5 19.28% 14761.01 13975 18328 81048
miss 0.0 0.09% 0.00 0 0 0

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 395 1.5% 28.5 16.08sec 6281 0 4373 9010 10861 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 0.0000 0.0000 178831
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 58.67% 4372.93 4172 5256 73034
crit 11.7 41.24% 9010.21 8595 10861 105797
dodge 0.0 0.09% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 2629 10.0% 141.0 9.53sec 8430 0 5867 12091 14231 41.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
141.02 141.02 0.00 0.00 0.0000 0.0000 1188690
Direct Results Count Pct Average Min Max Total Damage
hit 82.7 58.65% 5866.74 5640 6908 485239
crit 58.2 41.26% 12091.48 11617 14231 703451
dodge 0.1 0.09% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 936
wolf_melee 936 100.0% 89.1 4.68sec 4401 3262 4672 9357 10970 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.11 89.11 0.00 0.00 1.3492 0.0000 392181
Direct Results Count Pct Average Min Max Total Damage
hit 67.5 75.77% 4672.47 4448 5485 315452
crit 0.2 0.20% 9356.91 8897 10970 1682
glance 21.4 24.03% 3504.41 3336 4114 75047

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 600
earth_melee 600 100.0% 59.0 2.00sec 1305 652 1346 2692 2815 3.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 76992
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 73.06% 1345.80 1315 1407 58011
crit 1.8 2.98% 2691.84 2629 2815 4733
glance 14.1 23.92% 1009.38 986 1056 14247
dodge 0.0 0.04% 0.00 0 0 0

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372
bloodlust mana 0.0% 0.0 1523
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 9.6% 10.8 1054
fire_nova mana 18.1% 0.0 1288
flame_shock mana 5.7% 25.4 996
flametongue_oh mana 29.6% 8.3 351
lava_lash mana 9.9% 38.3 937
lightning_bolt mana 0.9% 337.8 59
searing_totem mana 0.6% 497.6 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 21.5% 8.0 1874
unleash_elements mana 2.9% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 23476.1 13.0 20.4%
initial_mana none 1.0 25595.0 25595.0 0.0%
mp5_regen mana 1809.3 85664.9 47.3 19.1%
primal_wisdom mana 323.9 282869.9 873.2 25.5%
replenishment mana 1809.3 9262.3 5.1 20.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 9.8 77.4 46.1sec 5.1sec 91% 90%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 921.0 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 72.8 289.5 6.2sec 1.2sec 86% 85%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.9 7.8 37.4sec 21.9sec 40% 43%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 10.4 5.0 42.0sec 27.6sec 34% 35%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 65.8 284.9 6.9sec 1.3sec 80% 89%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.6 44.3 209.2sec 9.9sec 98% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 338.8sec 338.8sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.5 0.0 16.1sec 16.1sec 20% 34%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.5 0.0 16.1sec 16.1sec 21% 29%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 38.3 12.1sec
flametongue_icd 15.8 26.9sec
maelstrom_weapon 350.7 1.5sec
static_shock 39.8 11.3sec
swings_clipped_mh 3.1 96.5sec
swings_clipped_oh 3.1 94.6sec
wasted_maelstrom_weapon 37.0 13.5sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 71.50%
σ of the average dps 5.3336
2 * σ / μ 0.0407%
95% Confidence Intervall ( μ ± 2σ ) ( 26220.32 - 26241.66 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26214.99 - 26246.99 )
Sample Data
σ 533.3575
Minimum 24104.80
Maximum 28320.81
Spread ( max - min ) 4216.01
Range ( max - min ) / 2 2108.00
Range% 8.04
10th Percentile 25559.90
90th Percentile 26922.83
( 90th Percentile - 10th Percentile ) 1362.93
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1653
0.1 scale factor error with delta=300 2528
0.05 scale factor error with delta=300 10114
0.01 scale factor error with delta=300 252862
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react

Sample Sequence

012378AEFGIHJLMHNOGKLHOIKOGHLJOQOGHIKLHOKGOHLJIHOGKLHFHKOGILJHOQGKLHOIJOGHLKOQGIKHLOJGOLKOIHGKFELOQJOGILKHMOGHKLOIHJGLOKOQLGIHJOLHOGKOLHIFJGLHOKOLGHIJHLHOGKOLHIJOGHLKOHOGIHJLOQGKFELOHIJGLHOKMOLGIHJOLHOGKOHILJHGOKLOQKGIHLJFOHGKHLIHKOGLHJOLGHIKOLHOGJOHLIKOGHLKOQGFIEJHLOKGOLHIJHGLHKMHOLGHIJOLHOGKOLIHJGLHOFKQOGIKLHOJGOLHKIOHGKLHOJOGIKHLOHGKOLHIJOGFLEHKOGIJLHOHKGLHOIJMLGHKOQLOIGHJLHOKGOLHIFKOGHL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7775 5075 4756
Stamina 7541 5924 5775
Intellect 163 156 20
Spirit 178 178 20
Health 142355 119773 0
Mana 25595 25490 0
Spell Power 11357 5448 0
Spell Hit 16.91% 16.91% 1712
Spell Crit 16.13% 11.12% 1018
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 18248 10603 190
Melee Hit 20.25% 20.25% 1712
Melee Crit 40.53% 27.22% 1018
Melee Haste 5.13% 5.13% 657
Expertise 22.65 22.65 440
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 24.24% 16.86% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.20% 17.20% 1650

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Seasoned Winds 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372
origin="http://chardev.org/?profile=39863"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3022003000000000000230332001302301232100000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4756
# gear_stamina=5775
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=440
# gear_hit_rating=1712
# gear_crit_rating=1018
# gear_haste_rating=657
# gear_mastery_rating=1650
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Shaman_Enh_T11_372_Caster : 25944dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25943.6 8.65 / 0.03% 27.4 947.8 944.2 mana 0.82% 44.2
Origin http://chardev.org/?profile=39882
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:23473|22407|17767|15816|10115|7022|3211|2386|1411|741&chds=0,46945&chco=C41F3B,C41F3B,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23473++lava_lash,C41F3B,0,0,15|t++22407++flame_shock,C41F3B,1,0,15|t++17767++lightning_bolt,336600,2,0,15|t++15816++lava_burst,C41F3B,3,0,15|t++10115++earth_shock,336600,4,0,15|t++7022++stormstrike,C79C6E,5,0,15|t++3211++wolf_melee,C79C6E,6,0,15|t++2386++melee_main_hand,C79C6E,7,0,15|t++1411++melee_off_hand,C79C6E,8,0,15|t++741++earth_melee,C79C6E,9,0,15&chtt=Shaman_Enh_T11_372_Caster+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x390&cht=p&chf=bg,s,333333&chd=t:13,13,12,8,7,7,6,5,4,4,3,3,3,3,3,2,2,1,1&chds=0,100&chco=336600,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,C41F3B,C79C6E,336600,C41F3B,C41F3B,C79C6E,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E&chl=lightning_bolt|lava_lash|searing_totem|melee_main_hand|flametongue_oh|windfury_mh|flame_shock|melee_off_hand|earth_shock|searing_flames|lava_burst|wolf_melee|darkmoon_card_hurricane|unleash_flame|lightning_shield|stormstrike_mh|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372_Caster+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7877777655566565566555555556411123445455444344444555555555566665566666666654444445555555555555543334455555543333344555566665555555666666666654444455556555555555444455555555443334555666666555555555555555555544444455555554444555444455555555444455556666555555666666556665555444445555555544444555555555555555555555556555544444555555555555554444445555555444444455555555555555555555665555555555555555555555444444455555544444455555555555555554444555555544444&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=27777&chtt=Shaman_Enh_T11_372_Caster+Mana+Timeline&chts=dddddd,18&chco=2459FF http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x445444444487776555665333343200zyxxwwwvwuuuttsrqqpppooopppqqqqpoooopoppqqrqqpqqqqqqqqppppqqrrqqqpppppppqqrrrqppqqqqqqqqqqrsttttttstttuuuvvvvvvuuuuttttttssssssrrrqqpppppppppppoooooooooooooooppppooooooopppppppooooooooopppppppppoooonnnooppqqppppqqrrrssttttuuuuuuuuuttuuuuuuutttsssssrrrrrqqqqppooooooooooppoooooooooopppppppppppooooooopppppppooooooooppppoooooooooppppqqrrrrrsssssstttuuuuuuuuuuuuuuttttttttssrrrqqqpppppppooooooooooooooopppooooooooooppppppooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25944|max=35658&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,2,0,2,4,18,23,22,37,59,86,111,141,194,291,326,368,441,490,553,640,609,648,649,644,573,543,475,397,373,281,246,208,142,104,91,68,43,35,24,10,9,5,2,5,0,1,3&chds=0,649&chbh=5&chxt=x&chxl=0:|min=24218|avg=25944|max=27693&chxp=0,1,50,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372_Caster 25944
darkmoon_card_hurricane 825 3.2% 32.5 14.08sec 11477 0 8040 16562 16562 40.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.52 32.52 0.00 0.00 0.0000 0.0000 373221
Direct Results Count Pct Average Min Max Total Damage
hit 19.4 59.67% 8039.87 8040 8040 156022
crit 13.1 40.33% 16562.13 16562 16562 217199

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1039 4.0% 34.7 12.87sec 13530 10115 10463 16168 19757 53.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.72 34.72 0.00 0.00 1.3376 0.0000 469710
Direct Results Count Pct Average Min Max Total Damage
hit 16.1 46.24% 10463.05 10022 12787 167957
crit 18.7 53.76% 16168.19 15483 19757 301753

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
fire_nova 0 0.0% 56.1 7.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
56.08 0.00 0.00 0.00 1.3389 0.0000 0

Action details: fire_nova

Static Values
  • id:1535
  • school:fire
  • resource:mana
  • tree:elemental
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5154.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites your Flame Shock spell on any nearby enemies, causing each of them to emit a wave of flames that deals $8349s2 Fire damage to every other enemy within $8349A2 yards.
flame_shock 1580 6.1% 23.7 19.32sec 30132 22407 7053 10902 14164 19.1% 0.0% 0.0% 0.0% 156 3071 4746 18.9% 0.0% 91.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.71 23.71 156.36 156.36 1.3448 2.6569 714471
Direct Results Count Pct Average Min Max Total Damage
hit 19.2 80.89% 7053.07 5582 9167 135270
crit 4.5 19.11% 10902.34 8624 14164 49412
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 81.07% 3071.33 2427 4050 389335
crit 29.6 18.93% 4746.15 3750 6258 140454

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 1944 7.5% 304.6 1.48sec 2887 0 2616 4041 5146 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
304.56 304.56 0.00 0.00 0.0000 0.0000 879253
Direct Results Count Pct Average Min Max Total Damage
hit 246.7 81.00% 2616.15 2468 3331 645376
crit 57.9 19.00% 4041.36 3813 5146 233877

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_burst 883 3.4% 13.9 31.00sec 28677 15816 0 28685 41647 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.93 13.92 0.00 0.00 1.8132 0.0000 399366
Direct Results Count Pct Average Min Max Total Damage
crit 13.9 100.00% 28684.91 27821 41647 399366

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_lash 3272 12.6% 41.8 10.92sec 35367 23473 24763 51097 62931 40.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.83 41.83 0.00 0.00 1.5068 0.0000 1479384
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 59.73% 24762.64 18215 30549 618692
crit 16.8 40.27% 51096.94 37523 62931 860692

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3418 13.2% 64.8 6.93sec 23844 17767 17728 27344 34011 63.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
64.82 64.80 0.00 0.00 1.3420 0.0000 1545646
Direct Results Count Pct Average Min Max Total Damage
hit 23.5 36.32% 17728.33 16897 22013 417252
crit 41.3 63.68% 27343.85 26106 34011 1128393

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 731 2.8% 40.0 11.37sec 8257 0 6565 10122 12493 52.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.01 40.01 0.00 0.00 0.0000 0.0000 330370
Direct Results Count Pct Average Min Max Total Damage
hit 18.1 45.32% 6565.11 6246 8086 119059
crit 20.9 52.18% 10121.61 9651 12493 211311
none 1.0 2.50% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2087 8.0% 361.3 1.25sec 2611 2386 2018 4160 5234 40.5% 7.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
361.31 361.31 0.00 0.00 1.0946 0.0000 943517
Direct Results Count Pct Average Min Max Total Damage
hit 101.1 27.97% 2018.02 1913 2541 203938
crit 146.3 40.49% 4159.57 3942 5234 608459
glance 86.6 23.97% 1513.97 1435 1906 131119
dodge 1.8 0.49% 0.00 0 0 0
miss 25.6 7.08% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1224 4.7% 248.5 1.82sec 2226 1411 1716 3537 4313 40.4% 7.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
248.54 248.54 0.00 0.00 1.5784 0.0000 553358
Direct Results Count Pct Average Min Max Total Damage
hit 71.0 28.56% 1715.69 1641 2094 121774
crit 100.3 40.37% 3536.71 3380 4313 354897
glance 59.6 23.97% 1287.15 1230 1570 76687
miss 17.6 7.10% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 967 3.7% 279.3 1.62sec 1566 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121 3354 5188 14.0% 0.0% 80.3%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.26 279.26 121.10 121.10 0.0000 3.0000 437216
Direct Results Count Pct Average Min Max Total Damage
hit 279.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.2 86.02% 3354.10 883 5795 349400
crit 16.9 13.98% 5188.20 1364 8953 87817

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:882.58
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 3154 12.2% 8.1 59.88sec 176840 174851 0 0 0 0.0% 0.0% 0.0% 0.0% 279 4628 7151 19.0% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.07 8.07 279.26 279.26 1.0114 1.6000 1426360
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 226.2 81.00% 4628.29 4413 5794 1046946
crit 53.1 19.00% 7150.79 6818 8951 379414

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 122.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.18 4.18 0.00 0.00 1.2954 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1055 4.1% 45.1 10.03sec 10576 7022 0 0 0 0.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.09 45.09 0.00 0.00 1.5060 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 44.9 99.49% 0.00 0 0 0
dodge 0.2 0.51% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 570 2.2% 44.9 10.08sec 5741 0 4018 8283 10435 40.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.86 44.86 0.00 0.00 0.0000 0.0000 257544
Direct Results Count Pct Average Min Max Total Damage
hit 26.7 59.59% 4017.84 3815 5066 107400
crit 18.1 40.41% 8282.63 7859 10435 150143

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 485 1.9% 44.9 10.08sec 4889 0 3422 7052 8599 40.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.86 44.86 0.00 0.00 0.0000 0.0000 219301
Direct Results Count Pct Average Min Max Total Damage
hit 26.7 59.60% 3422.06 3271 4174 91489
crit 18.1 40.40% 7052.40 6738 8599 127812

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.5 16.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 0.00 0.00 1.3385 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 787 3.0% 28.5 16.08sec 12489 0 11316 17483 21215 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 0.00 0.00 0.0000 0.0000 355701
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.98% 11315.98 10847 13803 261008
crit 5.4 19.02% 17482.97 16759 21215 94693

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 225 0.9% 28.5 16.08sec 3577 0 2517 5185 6496 40.2% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 0.00 0.00 0.0000 0.0000 101873
Direct Results Count Pct Average Min Max Total Damage
hit 16.9 59.33% 2517.35 2392 3165 42533
crit 11.4 40.19% 5185.31 4927 6496 59341
dodge 0.1 0.48% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 1702 6.6% 154.9 8.69sec 4968 0 3493 7198 8706 40.3% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
154.87 154.87 0.00 0.00 0.0000 0.0000 769432
Direct Results Count Pct Average Min Max Total Damage
hit 91.7 59.21% 3492.97 3348 4226 320319
crit 62.4 40.29% 7198.12 6897 8706 449114
dodge 0.8 0.50% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 924
wolf_melee 924 100.0% 89.6 4.67sec 4334 3211 4600 9197 10840 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.65 89.65 0.00 0.00 1.3498 0.0000 388479
Direct Results Count Pct Average Min Max Total Damage
hit 68.0 75.84% 4599.72 4384 5420 312718
crit 0.2 0.20% 9196.76 8767 10840 1677
glance 21.5 23.96% 3449.49 3288 4065 74085

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 682
earth_melee 682 100.0% 59.0 2.00sec 1482 741 1528 3056 3182 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 87431
Direct Results Count Pct Average Min Max Total Damage
hit 43.0 72.94% 1527.73 1395 1591 65749
crit 1.8 3.01% 3055.60 2997 3182 5427
glance 14.2 24.05% 1145.78 1046 1193 16256

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372_Caster
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 8.5% 12.8 1054
fire_nova mana 16.9% 0.0 1288
flame_shock mana 5.5% 30.3 996
flametongue_oh mana 25.0% 8.2 351
lava_burst mana 7.6% 12.2 2343
lava_lash mana 9.1% 37.7 937
lightning_bolt mana 3.4% 106.8 223
searing_totem mana 0.6% 604.1 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 19.7% 5.6 1874
unleash_elements mana 2.7% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 23732.9 13.1 19.5%
initial_mana none 1.0 28205.0 28205.0 0.0%
mp5_regen mana 1809.3 86380.7 47.7 18.5%
primal_wisdom mana 340.1 306581.7 901.5 23.0%
replenishment mana 1809.3 10290.3 5.7 19.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 7.8 91.5 58.0sec 4.5sec 94% 94%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 955.2 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 79.5 294.1 5.7sec 1.2sec 84% 84%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 10.6 5.4 41.4sec 26.7sec 34% 36%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.7 4.0 44.8sec 30.8sec 31% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 65.6 231.9 6.9sec 1.5sec 77% 83%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.5 43.4 223.1sec 10.1sec 99% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 338.6sec 338.6sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.5 0.0 16.1sec 16.1sec 17% 29%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.5 0.0 16.1sec 16.1sec 17% 26%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 4%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 32.5 14.1sec
flametongue_icd 13.0 32.5sec
maelstrom_weapon 297.5 1.7sec
static_shock 39.0 11.5sec
swings_clipped_mh 18.0 23.9sec
swings_clipped_oh 12.6 33.6sec
wasted_maelstrom_weapon 22.9 20.3sec
windfury 51.6 8.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.57%
σ of the average dps 4.3238
2 * σ / μ 0.0333%
95% Confidence Intervall ( μ ± 2σ ) ( 25934.98 - 25952.28 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25930.66 - 25956.60 )
Sample Data
σ 432.3813
Minimum 24218.41
Maximum 27693.48
Spread ( max - min ) 3475.07
Range ( max - min ) / 2 1737.53
Range% 6.70
10th Percentile 25401.65
90th Percentile 26511.16
( 90th Percentile - 10th Percentile ) 1109.51
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1111
0.1 scale factor error with delta=300 1661
0.05 scale factor error with delta=300 6647
0.01 scale factor error with delta=300 166181
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
R lava_burst,if=dot.flame_shock.remains>cast_time+0.5

Sample Sequence

012378AEFGIJLHMNOHGKLHORIJOGLOKQROLGIJOQRLKGOHQKILGHJOQFLHGIKHLOQKGQLQIHJOGLOHKOQIGJHLORKGOLHIJHOFEGKLOQMKIGHLJOQRGKLIOHKOGLQJOQILGHKOQLOHGIFJLOHRGKLOHIJOGLOHKORGIHJLOQRGKLOIKOGLOHJFOQEGIKLMHOKGLHJIOQGKHLOQKOGHIJLHORGKLOHIJOFGLKHOQRGIJLHOQKGLHOIKOLGHJORLKGIHOKLOQGJOFILKEHGOHKLMOIGHJLOQRGKLHIOKGLQJORLGHIKOLQFGKQLQIJOGLOKQORGIJLHOQKGLOQIJOLGHKOQLOIGJFHLOKERGOIKLHMOGJLHOIKOGLOHKOLGIHJOLHOGKOLHFIJGLHOK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7593 4901 4591
Stamina 7540 5923 5774
Intellect 337 321 185
Spirit 244 244 86
Health 142341 119759 0
Mana 28205 27965 0
Spell Power 13755 7646 2207
Spell Hit 17.15% 17.15% 1671
Spell Crit 15.79% 10.76% 908
Spell Haste 9.85% 4.62% 591
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 17848 10257 190
Melee Hit 19.91% 19.91% 1671
Melee Crit 39.36% 26.07% 908
Melee Haste 4.62% 4.62% 591
Expertise 24.02 24.02 481
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.79% 16.40% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.82% 17.82% 1760

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Seasoned Winds 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372_Caster
origin="http://chardev.org/?profile=39882"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3022003000000000000230332001302301232100000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
actions+=/lava_burst,if=dot.flame_shock.remains>cast_time+0.5
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4591
# gear_stamina=5774
# gear_intellect=185
# gear_spirit=86
# gear_spell_power=2207
# gear_attack_power=190
# gear_expertise_rating=481
# gear_hit_rating=1671
# gear_crit_rating=908
# gear_haste_rating=591
# gear_mastery_rating=1760
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=andoros_fist_of_the_dragon_king,heroic=1,weapon=mace_1.80speed_328min_611max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Warlock_AffDrain_T11_372_PTR : 29279dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
29279.3 11.64 / 0.04% 18.8 1561.5 1531.2 mana 0.00% 35.8
Origin http://chardev.org/?profile=36745
Talents http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • unstable_affliction
  • haunt

Charts

http://6.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:77924|22599|22043|16866|16742|15929|13394|11386|9659|4503|1253|518&chds=0,155847&chco=9482C9,435133,9482C9,9482C9,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++77924++unstable_affliction,9482C9,0,0,15|t++22599++fel_flame,435133,1,0,15|t++22043++shadow_bite,9482C9,2,0,15|t++16866++shadowflame,9482C9,3,0,15|t++16742++drain_soul,9482C9,4,0,15|t++15929++shadow_bolt,9482C9,5,0,15|t++13394++soul_fire,C41F3B,6,0,15|t++11386++haunt,9482C9,7,0,15|t++9659++drain_life,9482C9,8,0,15|t++4503++doombolt,9482C9,9,0,15|t++1253++felhunter_melee,C79C6E,10,0,15|t++518++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_AffDrain_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:16,15,15,14,12,9,4,4,3,3,2,1,1,1,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C41F3B,9482C9,9482C9,435133,9482C9,C79C6E,C41F3B,C41F3B&chl=shadow_bite|unstable_affliction|drain_life|corruption|drain_soul|bane_of_doom|haunt|felhunter_melee|shadowflame_dot|shadow_bolt|doombolt|fel_flame|shadowflame|ebon_imp_melee|soul_fire|darkmoon_card_volcano&chtt=Warlock_AffDrain_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7864zwvuttsvwvutrusrqqqqppoononmkjijjjiihjihfedeeeedceeedcbdddcaZbcbaaZaZYYXXZZZYXWXXXWVVXXWVVUWWVVUTVWVVVUWXWVUUVVVVUUVVTSRQSSSRRRSSSRRQSSRRQQSTSSRRTTTSSRTUTTSSTTSSRRSTSSRRSSSRRQSSRRQQRRQQPPRSRRRRTTTSRRTTTSSRTTSSRRSSSRRQSSRRRQRRRQQQRSRRQQSSRQQPRRRRQQRSRRQQRRRQQQRRRQQPRRQQQPRRQQPPRRRRQQSSSSRRTTTTSSTUTTSSTTSSRRTTTTSSUUTTTSUVUUUUVWWVVVXYYXXXZZZZYYaaaaZZbbbbaacccbZZaaaZYYaaaZZZbbbbbaddddcceeeeddfffffegggggghihhhhijjiiikkkkkkmmmllkmmmmmlnoonnnopooooq&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=105252&chtt=Warlock_AffDrain_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fhnpnpprwwwy014585645310y000ytsrrpqnnlqponmmllkiihjiikkkllkgffggheeeghhfefdddbbbccccddfffcbbdeeddehiihhiiiihhhjjjijjkkkhggiiiggghjjiiijiiggghhhgiikkkigghhhfffghiggghfecccdddcdefffdbbdddcccefgfffhffeeegggfffhhhgfegggeeegghgggiihfffhhhfghjjjhhgiiigggiijijjkjifffgggeeehhhffeeeecddffgghhjjigggiiighhkkkihghhgfffgghgghjjigghjjkijjmnonnnooommmnoomnnooolkkllkiiilllkkjkkkjjjlmmmnoqrrpporrrppprssqqqrqpmmmnnnlmmooomllmmmlllopqpppqqqopprssqrsuvvtsrttutttuvvtt&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=29279|max=48657&chxp=1,1,60,100&chtt=Warlock_AffDrain_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,3,3,8,21,19,50,67,103,144,205,279,318,418,514,537,629,677,658,666,670,634,563,520,453,409,329,296,218,147,122,110,66,49,33,20,11,9,8,5,2,1,0,1,0,1,0,0,1&chds=0,677&chbh=5&chxt=x&chxl=0:|min=27143|avg=29279|max=31992&chxp=0,1,44,100&chtt=Warlock_AffDrain_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_AffDrain_T11_372_PTR 29279
bane_of_doom 2633 9.0% 7.6 60.79sec 155720 152239 0 0 0 0.0% 0.1% 0.0% 0.0% 29 30233 62598 33.2% 0.0% 96.4%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.64 7.64 29.05 29.05 1.0229 15.0000 1190258
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.81% 30232.57 19289 44072 586772
crit 9.6 33.19% 62597.80 39637 93183 603487

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 4097 14.0% 1.0 1.03sec 1849869 1784083 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6243 12931 40.0% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 207.61 207.61 1.0369 2.1678 1851904
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.97% 6242.60 3716 10919 777259
crit 83.1 40.03% 12931.32 7635 22436 1074645

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.2% 10.1 46.54sec 3094 0 2698 4178 4896 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.10 10.10 0.00 0.00 0.0000 0.0000 31260
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.90% 2697.59 2601 3169 19872
crit 2.7 26.98% 4177.77 4019 4896 11388
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 4278 14.6% 101.3 3.29sec 19092 9659 0 0 0 0.0% 0.1% 0.0% 0.0% 230 6640 13779 24.9% 0.0% 36.4%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
101.27 101.27 229.63 229.63 1.9766 0.7172 1933495
Direct Results Count Pct Average Min Max Total Damage
hit 101.2 99.89% 0.00 0 0 0
miss 0.1 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 172.4 75.06% 6639.60 3848 11207 1144428
crit 57.3 24.94% 13779.43 7907 23029 789067

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3579 12.2% 13.1 8.76sec 123591 16742 0 0 0 0.0% 0.1% 0.0% 0.0% 42 30214 62592 25.3% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.09 13.09 42.11 42.11 7.3820 2.2214 1617675
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.68% 30214.34 18026 49038 950199
crit 10.7 25.32% 62592.17 37042 100766 667477

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards$?s58070[ and $58068s1% of $G his:her; total mana][]. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 321 1.1% 5.7 31.77sec 25461 22599 20116 41607 62020 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.70 5.70 0.00 0.00 1.1266 0.0000 145134
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 74.92% 20116.31 17884 30182 85911
crit 1.4 24.97% 41606.68 36749 62020 59223
miss 0.0 0.11% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 1300 4.4% 45.2 9.99sec 12994 11386 10291 21338 32477 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.23 45.05 0.00 0.00 1.1413 0.0000 587708
Direct Results Count Pct Average Min Max Total Damage
hit 33.7 74.84% 10291.18 8952 15805 346957
crit 11.3 25.05% 21337.74 18394 32477 240752
miss 0.0 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.557700
  • base_dd_min:922.01
  • base_dd_max:922.01
life_tap 0 0.0% 4.5 48.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.52 4.52 0.00 0.00 1.0141 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.5 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 800 2.7% 20.2 16.09sec 17919 15929 14130 29354 45053 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.17 20.17 0.00 0.00 1.1249 0.0000 361408
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 74.89% 14129.68 12503 21925 213422
crit 5.0 25.00% 29354.22 25691 45053 147986
miss 0.0 0.12% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1093 3.7% 25.9 13.13sec 19045 16866 2608 5389 7077 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.94 25.94 0.00 0.00 1.1291 0.0000 85493
Direct Results Count Pct Average Min Max Total Damage
hit 19.5 75.05% 2608.33 2406 3444 50778
crit 6.4 24.84% 5388.94 4943 7077 34715
miss 0.0 0.11% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 904 3.1% 25.9 13.13sec 15749 0 0 0 0 24.9% 0.1% 0.0% 0.0% 113 2848 5909 25.1% 0.0% 35.8%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.94 25.94 112.98 112.98 0.0000 1.4326 408492
Direct Results Count Pct Average Min Max Total Damage
hit 19.5 74.99% 0.00 0 0 0
crit 6.5 24.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 84.7 74.92% 2847.85 2488 4196 241076
crit 28.3 25.08% 5909.02 5113 8621 167417

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 100 0.3% 3.0 46.25sec 15002 13394 11645 24067 29259 27.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1201 0.0000 45006
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.73% 11645.13 9321 14239 25409
crit 0.8 27.14% 24066.82 19153 29259 19598
miss 0.0 0.13% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
unstable_affliction 4409 15.1% 22.5 15.40sec 88443 77924 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6706 13894 40.1% 0.0% 99.2%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.53 22.53 207.80 207.80 1.1350 2.1571 1992633
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.89% 6705.74 3971 11681 834539
crit 83.3 40.11% 13894.45 8159 24002 1158094

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.30
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - felhunter 5979
felhunter_melee 1252 20.9% 303.1 1.49sec 1867 1253 1677 3385 4420 17.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: felhunter_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
303.14 303.14 0.00 0.00 1.4900 0.0000 566113
Direct Results Count Pct Average Min Max Total Damage
hit 178.6 58.92% 1677.08 1545 2210 299535
crit 51.7 17.05% 3384.61 3090 4420 174924
glance 72.7 23.99% 1260.30 1159 1657 91653
dodge 0.1 0.04% 0.00 0 0 0

Action details: felhunter_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 4727 79.1% 75.9 6.00sec 28156 22043 22340 44982 71183 26.7% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.89 75.89 0.00 0.00 1.2773 0.0000 2136825
Direct Results Count Pct Average Min Max Total Damage
hit 54.9 72.33% 22340.38 9630 35681 1226335
crit 20.2 26.67% 44982.05 19212 71183 910491
miss 0.8 1.00% 0.00 0 0 0

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Bite the enemy, causing ${$M1+(1.228*($SP*0.5))} Shadow damage plus an additional $s3% damage for each of your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:500.17
  • base_dd_max:712.37
pet - doomguard 3951
doombolt 3951 100.0% 21.0 2.10sec 9462 4503 7815 15917 20846 27.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.1015 0.0000 198710
Direct Results Count Pct Average Min Max Total Damage
hit 14.4 71.86% 7814.84 6612 10449 112313
crit 5.4 27.14% 15916.89 13191 20846 86397
miss 0.2 1.00% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 205
ebon_imp_melee 205 100.0% 102.6 0.78sec 792 518 822 1644 1644 16.9% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.57 102.57 0.00 0.00 1.5284 0.0000 81250
Direct Results Count Pct Average Min Max Total Damage
hit 45.6 44.48% 822.05 822 822 37500
crit 17.4 16.92% 1644.11 1644 1644 28538
glance 24.7 24.05% 616.54 617 617 15211
dodge 6.7 6.53% 0.00 0 0 0
miss 8.2 8.02% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_AffDrain_T11_372_PTR
bane_of_doom mana 3.3% 50.5 3082
corruption mana 0.2% 1500.3 1233
demon_soul mana 1.4% 0.0 2367
drain_life mana 35.4% 7.7 2466
drain_soul mana 5.3% 43.0 2877
fel_flame mana 1.0% 20.6 1233
haunt mana 15.8% 5.3 2466
shadow_bolt mana 5.0% 10.3 1746
shadowflame mana 18.9% 3.7 5138
soul_fire mana 0.8% 8.1 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 9.8% 28.7 3082
pet - felhunter
shadow_bite mana 100.0% 49.2 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29136.4 16.1 1.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 4.5 148960.5 32976.3 0.0%
mana_feed mana 20.2 364428.4 18004.3 3.6%
mp5_regen mana 1809.3 91778.5 50.7 1.2%
replenishment mana 1809.3 51893.5 28.7 1.1%
pet - felhunter mana
initial_mana none 1.0 61978.4 61978.4 0.0%
mana_feed mana 4.5 721.1 159.6 99.2%
mana_spring_totem mana 1809.3 16490.9 9.1 44.1%
mp5_regen mana 1809.3 9263.3 5.1 41.6%
replenishment mana 1809.3 16765.1 9.3 43.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.6sec 106.6sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 67.8 0.0 6.7sec 6.7sec 15% 15%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_felhunter 4.3 0.0 120.8sec 120.8sec 19% 19%

Database details

  • id:79460
  • cooldown name:buff_demon_soul_felhunter
  • tooltip:Periodic shadow damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.3 43.7 293.1sec 10.0sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.9 0.0 47.6sec 47.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.2 63.9 321.6sec 6.9sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic Shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 23.2 2.7 18.4sec 16.5sec 16% 100%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.2sec 46.2sec 0% 1%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.0sec 78.6sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
felhunter-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $w1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $w1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.5sec
shadow_trance 25.9 16.5sec

Statistics & Data Analysis

DPS
Population
Convergence 68.54%
σ of the average dps 5.8206
2 * σ / μ 0.0398%
95% Confidence Intervall ( μ ± 2σ ) ( 29267.64 - 29290.92 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 29261.82 - 29296.74 )
Sample Data
σ 582.0597
Minimum 27142.58
Maximum 31991.75
Spread ( max - min ) 4849.17
Range ( max - min ) / 2 2424.58
Range% 8.28
10th Percentile 28431.22
90th Percentile 29889.76
( 90th Percentile - 10th Percentile ) 1458.55
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1580
0.1 scale factor error with delta=300 3011
0.05 scale factor error with delta=300 12045
0.01 scale factor error with delta=300 301149
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_felhunter
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 corruption,if=(!ticking|remains<tick_time)&miss_react
A unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
B bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
C haunt
D fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
E summon_doomguard
F drain_soul,interrupt=1,if=target.health_pct<=25
G shadowflame
H soulburn
I soul_fire,if=buff.soulburn.up
J shadow_bolt,if=buff.shadow_trance.react
K life_tap,mana_percentage<=5
L drain_life,interrupt=1
M life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
N fel_flame,moving=1
O life_tap

Sample Sequence

012346789ABCEGHILLLCALJLGLLCLLLALGCLLLLLCJAGLLCHILAGJLCBLLLACGLLLCLAGLLCJLLHIACGJLJLLCLAGLL68CLBLAGLCLLLJLACGLLLCDLGLACJLLGKCLALLCGLBLACLLGKLCJALLGJCLLLALCGLLJDDCJLGLLCAJ68LBGLCLJLALCGLJLLACLGLLJCLALGLCLJLAGCJLLBLCAGLLLCLLAGLCLLJLLACGKLLLCDDLGLLCAL68JLBGCLLALLCGLDLDCJLDGLDCLLLLAKCGLFCFBCF7CFCFCFCFC68FBFCFCFCFCFCFC

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 152668 128504 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 0
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_AffDrain_T11_372_PTR
origin="http://chardev.org/?profile=36745"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
glyphs=life_tap/shadow_bolt/corruption/unstable_affliction/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_felhunter
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_doomguard
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/shadow_bolt,if=buff.shadow_trance.react
actions+=/life_tap,mana_percentage<=5
actions+=/drain_life,interrupt=1
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Affliction_T11_372_PTR : 29075dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
29075.1 11.71 / 0.04% 20.9 1393.8 1230.8 mana 0.00% 36.1
Origin http://chardev.org/?profile=36750
Talents http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • unstable_affliction
  • haunt

Charts

http://7.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:78790|22829|21136|17054|16760|14019|11522|9799|4504|1253|518&chds=0,157579&chco=9482C9,435133,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++78790++unstable_affliction,9482C9,0,0,15|t++22829++fel_flame,435133,1,0,15|t++21136++shadow_bite,9482C9,2,0,15|t++17054++shadowflame,9482C9,3,0,15|t++16760++drain_soul,9482C9,4,0,15|t++14019++drain_life,9482C9,5,0,15|t++11522++haunt,9482C9,6,0,15|t++9799++shadow_bolt,9482C9,7,0,15|t++4504++doombolt,9482C9,8,0,15|t++1253++felhunter_melee,C79C6E,9,0,15|t++518++ebon_imp_melee,C79C6E,10,0,15&chtt=Warlock_Affliction_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:16,15,14,13,12,9,4,4,4,3,2,1,1,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C41F3B,9482C9,435133,9482C9,C79C6E,C41F3B&chl=shadow_bite|unstable_affliction|corruption|shadow_bolt|drain_soul|bane_of_doom|haunt|drain_life|felhunter_melee|shadowflame_dot|doombolt|fel_flame|shadowflame|ebon_imp_melee|darkmoon_card_volcano&chtt=Warlock_Affliction_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7764ztrqppooonnmkkihggffeeddcbaZXXYbfkmmllkkihgfffeeddeghijkmnnmmmmllkkihgfffeeddccbaZYYYZacegijjkjiihggfffeeeddccbbbbbcdfggggfffeddcbbaaZZYZacehjllllkjjihggffeeddcbbaaZZaabdefghiiiihhgfeeddddegijlmnnnnmmlkkjiihhgffeedcbbaaZZZaabcdefghiiiihhgeeeeefgghiiiiiiiiiihhgggffeddcbbaaaaabcefghiiiihhhggffeeedddcccbbbbbcddeeeeeeedddccbbbbbbccdeeffffffeeeddddcccbbbaaaaZZZZYYYYYYYYYXXXXXXXXXXXXXXXYYYYYYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWWWVVVUUUUUUUUUUUUUUUTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=105253&chtt=Warlock_Affliction_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:gipqprqrxxxy115575544320zzzzysrpqpqnnmqponmmkkkiihjiikkjkkjfffgggeeegggeeedccbbbcccccceeecbbdddcccfhhghhihhgggiijikkllljihjjjhhhjkljjjjhhfffgggfggiiigffgggeeeghiggghgfcccdddccdfffdcbcccbbbdeeeefgffdddfffeefhhhggfgggeeegghgggiihfeegggfghjjkiihjijhhijjkjjkkjifffgggedefggeeeeedccceefefgiiiggghhhgghjkkjiijihfffhhhgghjjjhhhjjjiijlmnmmnooommmnoommnopomllmlljjjllmkkkmlljjkmmmmmnqqrppoqqqppprrrqqqrrqnnmonnmmmoopnnmonnllmoopopprrrppprssqrruuvtttuuuttuvvwuu&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=29075|max=48367&chxp=1,1,60,100&chtt=Warlock_Affliction_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,0,4,11,5,23,19,43,54,73,119,155,198,248,302,354,407,445,498,568,599,583,576,578,575,490,493,468,364,345,302,208,196,146,127,115,92,57,43,26,17,28,17,11,3,3,0,5,4&chds=0,599&chbh=5&chxt=x&chxl=0:|min=26950|avg=29075|max=31162&chxp=0,1,50,100&chtt=Warlock_Affliction_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Affliction_T11_372_PTR 29075
bane_of_doom 2629 9.0% 7.6 61.00sec 155912 153467 0 0 0 0.0% 0.1% 0.0% 0.0% 29 30254 62675 33.2% 0.0% 96.1%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.62 7.62 28.97 28.97 1.0159 15.0000 1188360
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.3 66.78% 30254.47 19289 47580 585221
crit 9.6 33.22% 62674.80 39637 97770 603138

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 4127 14.2% 1.0 168.77sec 1817076 1748082 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6260 12964 40.1% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 208.43 208.43 1.0395 2.1595 1865410
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.94% 0.00 0 0 0
miss 0.0 0.06% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 59.88% 6260.42 4162 11314 781339
crit 83.6 40.12% 12964.42 8552 22436 1084071

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.2% 10.1 46.71sec 3092 0 2696 4172 4896 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.08 10.08 0.00 0.00 0.0000 0.0000 31155
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.87% 2695.96 2601 3169 19798
crit 2.7 27.01% 4172.04 4019 4896 11358
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 1279 4.4% 18.4 16.87sec 31461 14019 0 0 0 0.0% 0.1% 0.0% 0.0% 55 8189 17104 25.9% 0.0% 8.1%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.37 18.37 55.05 55.05 2.2441 0.6650 577939
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 40.8 74.09% 8189.31 4440 10720 333982
crit 14.3 25.91% 17104.38 9124 22028 243956

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3577 12.3% 13.2 8.69sec 122824 16760 0 0 0 0.0% 0.1% 0.0% 0.0% 42 30223 62584 25.4% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.16 13.16 42.05 42.05 7.3283 2.2206 1616631
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.59% 30223.32 18026 46450 947852
crit 10.7 25.41% 62584.03 37042 95447 668779

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards$?s58070[ and $58068s1% of $G his:her; total mana][]. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 314 1.1% 5.6 32.49sec 25406 22829 20118 41648 62020 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.58 5.58 0.00 0.00 1.1129 0.0000 141712
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.20% 20117.62 17884 30182 84383
crit 1.4 24.68% 41648.39 36749 62020 57329
miss 0.0 0.12% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 1286 4.4% 44.7 10.11sec 13002 11522 10299 21384 32477 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.71 44.52 0.00 0.00 1.1284 0.0000 581265
Direct Results Count Pct Average Min Max Total Damage
hit 33.4 74.92% 10299.45 8952 15805 343525
crit 11.1 24.97% 21383.96 18394 32477 237740
miss 0.1 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.557700
  • base_dd_min:922.01
  • base_dd_max:922.01
life_tap 0 0.0% 11.6 27.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.64 11.64 0.00 0.00 1.0069 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 11.6 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 3917 13.5% 102.1 3.11sec 17340 9799 13744 28403 42666 24.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.10 102.10 0.00 0.00 1.7696 0.0000 1770484
Direct Results Count Pct Average Min Max Total Damage
hit 76.8 75.26% 13743.85 12503 20764 1056102
crit 25.2 24.63% 28402.93 25691 42666 714382
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1071 3.7% 25.4 13.42sec 19063 17054 2608 5390 7077 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.39 25.39 0.00 0.00 1.1178 0.0000 83624
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 75.10% 2607.71 2406 3444 49716
crit 6.3 24.78% 5390.11 4943 7077 33908
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 886 3.0% 25.4 13.42sec 15769 0 0 0 0 25.0% 0.1% 0.0% 0.0% 111 2847 5907 25.1% 0.0% 35.1%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.39 25.39 110.76 110.76 0.0000 1.4304 400315
Direct Results Count Pct Average Min Max Total Damage
hit 19.0 74.87% 0.00 0 0 0
crit 6.4 25.03% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 83.0 74.92% 2846.67 2488 4196 236197
crit 27.8 25.08% 5907.21 5113 8621 164117

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soulburn 0 0.0% 3.0 118.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
unstable_affliction 4402 15.1% 22.6 15.40sec 88109 78790 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6699 13866 40.1% 0.0% 99.2%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.58 22.58 207.91 207.91 1.1183 2.1556 1989784
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.6 59.94% 6698.64 3971 12097 834792
crit 83.3 40.06% 13866.50 8159 24002 1154992

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.30
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - felhunter 5785
felhunter_melee 1252 21.6% 303.1 1.49sec 1867 1253 1677 3384 4420 17.1% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: felhunter_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
303.14 303.14 0.00 0.00 1.4900 0.0000 566029
Direct Results Count Pct Average Min Max Total Damage
hit 178.5 58.89% 1676.89 1545 2210 299364
crit 51.7 17.05% 3383.93 3090 4420 174948
glance 72.8 24.01% 1260.22 1159 1657 91718
dodge 0.1 0.04% 0.00 0 0 0

Action details: felhunter_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 4533 78.4% 75.9 6.00sec 26997 21136 21432 43207 71183 26.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.89 75.89 0.00 0.00 1.2773 0.0000 2048912
Direct Results Count Pct Average Min Max Total Damage
hit 55.0 72.47% 21432.04 9630 35681 1178758
crit 20.1 26.54% 43207.18 19212 71183 870154
miss 0.8 0.99% 0.00 0 0 0

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Bite the enemy, causing ${$M1+(1.228*($SP*0.5))} Shadow damage plus an additional $s3% damage for each of your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:500.17
  • base_dd_max:712.37
pet - doomguard 3952
doombolt 3952 100.0% 21.0 2.10sec 9465 4504 7809 15937 20846 27.2% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.1015 0.0000 198767
Direct Results Count Pct Average Min Max Total Damage
hit 14.4 71.82% 7809.23 6612 10449 112170
crit 5.4 27.17% 15936.94 13191 20846 86597
miss 0.2 1.01% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 204
ebon_imp_melee 204 100.0% 102.1 0.78sec 792 518 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.13 102.13 0.00 0.00 1.5284 0.0000 80922
Direct Results Count Pct Average Min Max Total Damage
hit 45.6 44.64% 822.05 822 822 37478
crit 17.2 16.87% 1644.11 1644 1644 28322
glance 24.5 24.02% 616.54 617 617 15122
dodge 6.7 6.53% 0.00 0 0 0
miss 8.1 7.94% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Affliction_T11_372_PTR
bane_of_doom mana 3.7% 50.6 3082
corruption mana 0.2% 1473.7 1233
demon_soul mana 1.6% 0.0 2366
drain_life mana 7.2% 12.8 2466
drain_soul mana 6.0% 42.7 2877
fel_flame mana 1.1% 20.6 1233
haunt mana 17.5% 5.3 2466
shadow_bolt mana 28.3% 9.9 1746
shadowflame mana 20.7% 3.7 5138
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 11.0% 28.6 3082
pet - felhunter
shadow_bite mana 100.0% 47.2 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29428.7 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 11.6 375950.6 32289.8 0.0%
mp5_regen mana 1809.3 92695.7 51.2 0.2%
replenishment mana 1809.3 52362.8 28.9 0.2%
pet - felhunter mana
initial_mana none 1.0 61978.4 61978.4 0.0%
mana_spring_totem mana 1809.3 16767.1 9.3 43.2%
mp5_regen mana 1809.3 9419.8 5.2 40.6%
replenishment mana 1809.3 17053.4 9.4 42.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.5sec 106.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.9sec 120.9sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 158.4 0.0 2.8sec 2.8sec 51% 51%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_felhunter 4.3 0.0 120.9sec 120.9sec 19% 22%

Database details

  • id:79460
  • cooldown name:buff_demon_soul_felhunter
  • tooltip:Periodic shadow damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.6 3.0 44.5sec 33.1sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.5 42.9 211.5sec 10.1sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 47.9sec 47.9sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.3 145.2 275.4sec 3.0sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic Shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 15.4 3.5 28.2sec 22.8sec 18% 11%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 118.3sec 118.3sec 0% 8%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.6sec 78.9sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
felhunter-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $w1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $w1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.9sec
shadow_trance 18.9 22.8sec

Statistics & Data Analysis

DPS
Population
Convergence 68.25%
σ of the average dps 5.8557
2 * σ / μ 0.0403%
95% Confidence Intervall ( μ ± 2σ ) ( 29063.36 - 29086.78 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 29057.50 - 29092.64 )
Sample Data
σ 585.5730
Minimum 26949.88
Maximum 31162.30
Spread ( max - min ) 4212.42
Range ( max - min ) / 2 2106.21
Range% 7.24
10th Percentile 28228.17
90th Percentile 29684.53
( 90th Percentile - 10th Percentile ) 1456.36
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1622
0.1 scale factor error with delta=300 3047
0.05 scale factor error with delta=300 12191
0.01 scale factor error with delta=300 304796
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_felhunter
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 corruption,if=(!ticking|remains<tick_time)&miss_react
A unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
B bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
C haunt
D fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
E summon_doomguard
F drain_soul,interrupt=1,if=target.health_pct<=25
G shadowflame
H life_tap,mana_percentage<=35
I soulburn,if=buff.demon_soul_felhunter.up
J drain_life,if=buff.demon_soul_felhunter.up
K shadow_bolt
L life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
M fel_flame,moving=1
N life_tap

Sample Sequence

012346789ABCEGIJJJCJAJGJCKKKKKACGKKKHKCKAGKKCKKKKACGHKBKKCAKGKKKCKKKGACKKHKKCGKAKKKCKGKAKCHK68IJGBJACJJGJCJAHKKCGKKKAKCKKGKKCKKAHKGCKKKKKBACGHKKKKKCKGAKKCKKKKGACKKKKKCGAHKKKKCK68IJGHJABCJJJGCJAKKKCKGKKKACHKGKKCKAKKGHCKKDKKCGBKAKKKCKKGDKKCDHKKGKACKKKKCGKAKKCK68HGJACJBJGJCHAJKKKCGKDKKCDKGKKACKFCFCFBF7CFCFCFCF68CFBCFCFCFCFCF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 7977 6289 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 149490 125956 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 1
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 0
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Affliction_T11_372_PTR
origin="http://chardev.org/?profile=36750"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
glyphs=life_tap/shadow_bolt/corruption/unstable_affliction/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_felhunter
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_doomguard
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/life_tap,mana_percentage<=35
actions+=/soulburn,if=buff.demon_soul_felhunter.up
actions+=/drain_life,if=buff.demon_soul_felhunter.up
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Demonology_T11_372_PTR : 27042dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27042.3 13.48 / 0.05% 16.6 1625.2 1547.4 mana 0.00% 42.7
Origin http://chardev.org/?profile=36757
Talents http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • immolate
  • lash_of_pain
  • metamorphosis

Charts

http://8.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:83324|69298|31458|23683|20804|16667|13380|12133|10179|7034|4647|512&chds=0,166648&chco=9482C9,C41F3B,9482C9,435133,9482C9,435133,C41F3B,C41F3B,9482C9,9482C9,9482C9,C79C6E&chm=t++83324++bane_of_doom,9482C9,0,0,15|t++69298++immolation_aura,C41F3B,1,0,15|t++31458++corruption,9482C9,2,0,15|t++23683++fel_flame,435133,3,0,15|t++20804++shadowflame,9482C9,4,0,15|t++16667++hand_of_guldan,435133,5,0,15|t++13380++incinerate,C41F3B,6,0,15|t++12133++soul_fire,C41F3B,7,0,15|t++10179++shadow_bolt,9482C9,8,0,15|t++7034++lash_of_pain,9482C9,9,0,15|t++4647++doombolt,9482C9,10,0,15|t++512++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_Demonology_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:26,17,11,7,7,6,6,6,4,3,2,2,2,1,0&chds=0,100&chco=9482C9,9482C9,C41F3B,9482C9,C41F3B,9482C9,435133,C41F3B,C41F3B,C41F3B,9482C9,435133,C79C6E,9482C9,C41F3B&chl=lash_of_pain|shadow_bolt|immolate|corruption|soul_fire|bane_of_doom|hand_of_guldan|shadowflame_dot|incinerate|immolation_aura|doombolt|fel_flame|ebon_imp_melee|shadowflame|darkmoon_card_volcano&chtt=Warlock_Demonology_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7876662yyyyyyzzzzxyxyyyyyyyyywwwwwwwwwwwwwvvvvvwwxxxyzzzzyz00zzzzzzzzzzyyyyyyyyyxxxxwwwwwwwwvvvvvvuvwwwxxxxxxxwwwwwxxxxxxwvvvvvvuuuuuuuuutttttuuuvvvvvvwwxxxxxxxxxxxxxwwwwwwwwwwwvvvvvuuuuuutuuuuvvwwwwwwwwwwwwwwwxwwwwwwwvwwwwwwwwwwwvwwwwwxxxyyyyyxxyyyyyxxxxxwwwwvwvvvwvvvvvvvvuuvvvvvuvvvvvvwwwxwwxxxxxwwwwwwvvvvvvvvvvvvvvuuuuuuuuuuvvvvvvvwvwwwwwwwwwwwvvvvvvvvvuvuuuuutttttttssssssssttttttttttttttsssttssssssssssrrrrrrrrrrrrrrrqqqqqqqqqqrrqqqqqqqqqqqpppp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=104704&chtt=Warlock_Demonology_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:pqsvux00022456777453444221ywutrpooomnnnmmljiigghgffhiiihhffeeeeedcdddccbaZZYYYYYYZZaaaaZZZabbccdeffggggfgggggghhihhhhfeeeeeeeddeeeedcccbccccccddddddccbbbbbbbcccbbaZZYZZZZZZaaaaaaZYZZZZabbbcddddcccdddddddeeeeeedddcdddddddddedddddddddddeeeddcccccdcccccdcccbbbaaaaaaabbbbbaaaaaaaaabccddddddddddddddeeeedccbbbbbbbbcbcccccccdddeeeffgggggfffffffffggfffeddccbbbbcccccbbbaaabbbbbcddeeddddeeeeeeffffeeedddcccccdddddccbbbcccddefffffffefffffgghhhhggfffffffffgfggg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27042|max=52293&chxp=1,1,52,100&chtt=Warlock_Demonology_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,4,2,9,9,26,39,55,100,138,179,223,304,359,470,526,540,643,663,634,669,607,568,555,513,400,352,284,240,243,155,129,105,79,46,44,25,20,12,10,12,2,0,2,2,1,0,0,0,1&chds=0,669&chbh=5&chxt=x&chxl=0:|min=24836|avg=27042|max=29279&chxp=0,1,50,100&chtt=Warlock_Demonology_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Demonology_T11_372_PTR 27042
bane_of_doom 1653 6.1% 7.7 60.80sec 97358 83324 0 0 0 0.0% 0.1% 0.0% 0.0% 29 20186 41716 25.2% 0.0% 96.8%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 29.19 29.19 1.1684 15.0000 747583
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 74.80% 20186.31 14593 33391 440774
crit 7.4 25.20% 41715.96 29987 68613 306808

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 1958 7.2% 24.2 18.69sec 36557 31458 0 0 0 0.0% 0.1% 0.0% 0.0% 197 3539 7355 25.2% 0.0% 99.0%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.21 24.21 196.70 196.70 1.1621 2.2754 885089
Direct Results Count Pct Average Min Max Total Damage
hit 24.2 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.2 74.83% 3539.25 2574 6406 520956
crit 49.5 25.17% 7354.95 5288 13163 364133

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 97 0.4% 10.1 46.62sec 4331 0 3771 5846 8484 27.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.14 10.14 0.00 0.00 0.0000 0.0000 43926
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.71% 3770.59 3052 5491 27807
crit 2.8 27.18% 5846.48 4715 8484 16119
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 473 1.8% 7.7 35.55sec 27650 23683 21918 45383 82677 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.74 7.72 0.00 0.00 1.1675 0.0000 214036
Direct Results Count Pct Average Min Max Total Damage
hit 5.8 75.04% 21917.83 16137 40235 126992
crit 1.9 24.84% 45382.64 33159 82677 87044
miss 0.0 0.12% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
hand_of_guldan 1638 6.1% 31.3 14.50sec 23679 16667 18667 38799 69289 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.28 31.26 0.00 0.00 1.4207 0.0000 740611
Direct Results Count Pct Average Min Max Total Damage
hit 23.4 74.82% 18667.16 13931 33720 436617
crit 7.8 25.06% 38798.99 28627 69289 303994
miss 0.0 0.12% 0.00 0 0 0

Action details: hand_of_guldan

Static Values
  • id:71521
  • school:shadowflame
  • resource:mana
  • tree:demonology
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a falling meteor down upon the enemy target, dealing $71521s1 Shadowflame damage and erupts an aura of magic within $86000a1 yards, causing all targets within it to have a $86000s1% increased chance to be critically hit by any Warlock demons. The aura lasts for $86041d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.968000
  • base_dd_min:1405.76
  • base_dd_max:1660.24
immolate 2857 10.6% 1.0 225.72sec 1251153 1236969 8488 17493 20407 28.2% 0.0% 0.0% 0.0% 196 5150 10711 25.0% 0.0% 99.1%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 195.71 195.71 1.0115 2.2890 1291815
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.72% 8488.36 4297 9931 6286
crit 0.3 28.23% 17492.75 8829 20407 5099
miss 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 146.7 74.96% 5149.79 3781 8906 755472
crit 49.0 25.04% 10710.99 7769 18300 524959

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
immolation_aura 746 2.8% 5.0 95.36sec 67424 69298 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3379 0 0.0% 0.1% 0.0%

Stats details: immolation_aura

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 99.90 0.9730 0.0000 337163
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 99.8 99.89% 3378.98 2914 4271 337163
miss 0.1 0.11% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:50590
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites the area surrounds you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.100000
  • base_dd_min:566.82
  • base_dd_max:566.82

Action details: immolation_aura

Static Values
  • id:50589
  • school:fire
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:13153.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damaging all nearby enemies.
  • description:Ignites the area surrounding you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 1175 4.3% 31.8 12.20sec 16721 13380 13244 27450 49886 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.78 31.64 0.00 0.00 1.2497 0.0000 531426
Direct Results Count Pct Average Min Max Total Damage
hit 23.7 74.78% 13244.28 8886 24277 313366
crit 7.9 25.11% 27449.56 17220 49886 218059
miss 0.0 0.12% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
metamorphosis 0 0.0% 5.0 95.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0

Action details: metamorphosis

Static Values
  • id:47241
  • school:physical
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • description:You transform into a Demon for $47241d. This form increases your armor contribution from items by $47241s2%, damage by $47241s3%, reduces the chance you'll be critically hit by melee attacks by $54879s1% and reduces the duration of stun and snare effects by $54817s1%. You gain some unique demon abilities in addition to your normal abilities.
shadow_bolt 4564 16.9% 104.5 3.21sec 19742 10179 15580 32407 63578 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
104.52 104.52 0.00 0.00 1.9395 0.0000 2063477
Direct Results Count Pct Average Min Max Total Damage
hit 78.4 75.04% 15579.51 11281 30940 1221893
crit 26.0 24.85% 32407.26 23181 63578 841584
miss 0.1 0.12% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1859 6.9% 34.6 13.17sec 24323 20804 2824 5834 9434 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.55 34.55 0.00 0.00 1.1692 0.0000 123407
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.92% 2823.62 2171 4591 73087
crit 8.6 24.96% 5834.02 4460 9434 50320
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1586 5.9% 34.6 13.17sec 20751 0 0 0 0 25.1% 0.1% 0.0% 0.0% 140 4039 8393 25.0% 0.0% 47.4%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.55 34.55 139.80 139.80 0.0000 1.5334 716977
Direct Results Count Pct Average Min Max Total Damage
hit 25.8 74.78% 0.00 0 0 0
crit 8.7 25.11% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.8 74.98% 4038.98 2919 7271 423358
crit 35.0 25.02% 8393.44 5998 14940 293619

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1864 6.9% 48.5 9.38sec 17396 12133 13897 28845 50705 25.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.45 47.67 0.00 0.00 1.4337 0.0000 842839
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 74.44% 13897.25 10933 24676 493125
crit 12.1 25.44% 28844.53 22467 50705 349714
miss 0.1 0.12% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
pet - succubus 7058
lash_of_pain 7058 100.0% 301.1 1.51sec 10588 7034 7819 15690 23200 36.2% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.10 301.10 0.00 0.00 1.5051 0.0000 3187963
Direct Results Count Pct Average Min Max Total Damage
hit 189.2 62.84% 7818.77 6892 11629 1479424
crit 108.9 36.16% 15690.17 13750 23200 1708539
miss 3.0 0.99% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - doomguard 4063
doombolt 4063 100.0% 30.0 2.13sec 9876 4647 7500 15144 20846 36.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.00 29.00 0.00 0.00 2.1255 0.0000 296290
Direct Results Count Pct Average Min Max Total Damage
hit 18.1 62.49% 7499.70 6612 10449 135916
crit 10.6 36.52% 15143.73 13191 20846 160374
miss 0.3 0.99% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 463
ebon_imp_melee 463 100.0% 257.6 0.79sec 792 512 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
257.58 257.58 0.00 0.00 1.5458 0.0000 204050
Direct Results Count Pct Average Min Max Total Damage
hit 114.8 44.59% 822.05 822 822 94412
crit 43.5 16.88% 1644.11 1644 1644 71506
glance 61.8 24.01% 616.54 617 617 38132
dodge 16.8 6.52% 0.00 0 0 0
miss 20.6 8.00% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Demonology_T11_372_PTR
bane_of_doom mana 3.2% 31.6 3082
corruption mana 4.1% 29.6 1233
demon_soul mana 1.4% 0.0 3082
fel_flame mana 1.3% 22.4 1233
hand_of_guldan mana 6.1% 16.5 1438
immolate mana 0.2% 761.0 1644
immolation_aura mana 7.2% 6.4 10523
incinerate mana 12.4% 5.8 2877
shadow_bolt mana 24.8% 11.3 1746
shadowflame mana 24.2% 4.7 5138
soul_fire mana 12.2% 9.4 1849
soulburn soul_shards 100.0% 0.0 1
pet - succubus
lash_of_pain mana 100.0% 18.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29089.7 16.1 1.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 0.9 24346.0 28054.8 0.0%
mana_feed mana 108.9 496839.8 4562.7 2.2%
mp5_regen mana 1809.3 91642.9 50.7 1.4%
replenishment mana 1809.3 51836.5 28.7 1.3%
pet - succubus mana
initial_mana none 1.0 60141.9 60141.9 0.0%
mana_feed mana 0.9 80.8 93.1 99.4%
mana_spring_totem mana 1809.3 8885.5 4.9 69.9%
mp5_regen mana 1809.3 154307.4 85.3 61.6%
replenishment mana 1809.3 8841.4 4.9 69.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.6sec 104.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 214.9 0.0 2.1sec 2.1sec 77% 77%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
decimation 1.0 53.3 65.0sec 2.1sec 24% 94%

Database details

  • id:63167
  • cooldown name:buff_decimation
  • tooltip:Your Soul Fire cast time is reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
demon_soul_succubus 3.3 0.0 122.0sec 122.0sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
hand_of_guldan 8.7 22.5 49.4sec 14.5sec 97% 97%

Database details

  • id:
  • cooldown name:buff_hand_of_guldan
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
metamorphosis 5.0 0.0 95.3sec 95.3sec 39% 68%

Database details

  • id:47241
  • cooldown name:buff_metamorphosis
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • max_stacks:1
  • duration:36.00
  • cooldown:0.00
  • default_chance:100.00%
molten_core 10.2 1.6 41.0sec 35.1sec 16% 100%

Database details

  • id:71165
  • cooldown name:buff_molten_core
  • tooltip:Increases damage done by $71165s1% and reduces cast time by $71165s3% of your Incinerate.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:6.00%
power_torrent_mh 9.9 0.0 47.8sec 47.8sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 46.7sec 46.7sec 0% 6%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.9 0.1 83.0sec 81.5sec 2% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.2sec 363.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $w1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $w1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 14.6 29.3sec
impending_doom 25.2 16.1sec

Statistics & Data Analysis

DPS
Population
Convergence 56.87%
σ of the average dps 6.7423
2 * σ / μ 0.0499%
95% Confidence Intervall ( μ ± 2σ ) ( 27028.84 - 27055.81 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27022.10 - 27062.55 )
Sample Data
σ 674.2341
Minimum 24835.77
Maximum 29279.26
Spread ( max - min ) 4443.49
Range ( max - min ) / 2 2221.75
Range% 8.22
10th Percentile 25967.37
90th Percentile 27369.24
( 90th Percentile - 10th Percentile ) 1401.87
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2486
0.1 scale factor error with delta=300 4040
0.05 scale factor error with delta=300 16163
0.01 scale factor error with delta=300 404081
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 metamorphosis
9 immolation,if=buff.metamorphosis.remains>10
A bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
B immolate,if=!ticking&target.time_to_die>=4&miss_react
C corruption,if=(remains<tick_time|!ticking)&target.time_to_die>=6&miss_react
D fel_flame,if=buff.tier11_4pc_caster.react
E shadowflame
F hand_of_guldan
G incinerate,if=buff.molten_core.react
H soulburn
I soul_fire,if=buff.decimation.react|buff.soulburn.up
J summon_doomguard
K life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
L demon_soul
M shadow_bolt
N life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
O fel_flame,moving=1
P life_tap

Sample Sequence

012346789ABCEFDDHIJLMMMMEMFCMMMMMEMMFMGGCGMEMMFMGGGEHICMMAF89MEMMMCMDDEFMMMMMECFMDDHIMMEMFMCMMMEM6AFMMMCELMMFMMMEMMCFMMMEMDDMFC89MEMMMMFAGEGCGGMMFMEMMMCMFMEMGGGMDDFCEDDGGGGGKFEMM6ACMMMEFLMMMMCMEFMMMMMEMCFMM89MEMMFMCMDADEMMFMMMCEMMFMMMEMGCGFGMMEMMMFMCMEM6MAMFMMCELMMMFGGGEMMCMFMMEMMM89FGCEGGGIIIIFAEIICIII7IFEIIIIIICIEFIIIIIIIEIFCIIIIIEIIFG6GGACDDEIIFGGGIIEICIFIIGGEGIIIFICIEIIIIIFIGEGG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8438 6652 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 155860 131038 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 27.20% 17.62% 2256
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 17.62% 17.62% 2256
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.87% 13.87% 1053

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 0
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 3
Dark Arts 3
Fel Synergy 2
Demonic Rebirth 2
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 3
Demonic Empowerment 1
Improved Health Funnel 0
Molten Core 3
Hand of Gul'dan 1
Aura of Foreboding 2
Ancient Grimoire 2
Inferno 1
Decimation 2
Cremation 2
Demonic Pact 1
Metamorphosis 1
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Demonology_T11_372_PTR
origin="http://chardev.org/?profile=36757"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
glyphs=life_tap/shadow_bolt/immolate/lash_of_pain/metamorphosis
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/metamorphosis
actions+=/immolation,if=buff.metamorphosis.remains>10
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/immolate,if=!ticking&target.time_to_die>=4&miss_react
actions+=/corruption,if=(remains=6&miss_react
actions+=/fel_flame,if=buff.tier11_4pc_caster.react
actions+=/shadowflame
actions+=/hand_of_guldan
actions+=/incinerate,if=buff.molten_core.react
actions+=/soulburn
actions+=/soul_fire,if=buff.decimation.react|buff.soulburn.up
actions+=/summon_doomguard
actions+=/life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2256
# gear_mastery_rating=1053
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Destruction_T11_372_PTR : 27629dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27628.9 9.50 / 0.03% 13.1 2117.0 2002.4 mana 0.00% 49.0
Origin http://chardev.org/?profile=36761
Talents http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
Glyphs
  • life_tap
  • immolate
  • imp
  • conflagrate

Charts

http://9.chart.apis.google.com/chart?chs=550x420&cht=bhg&chf=bg,s,333333&chd=t:63609|55131|27690|26886|26369|22282|17062|16093|13443|10858|4693|4391|524&chds=0,127217&chco=9482C9,C41F3B,C41F3B,435133,9482C9,9482C9,C41F3B,9482C9,C41F3B,C41F3B,C41F3B,9482C9,C79C6E&chm=t++63609++bane_of_doom,9482C9,0,0,15|t++55131++immolate,C41F3B,1,0,15|t++27690++conflagrate,C41F3B,2,0,15|t++26886++fel_flame,435133,3,0,15|t++26369++corruption,9482C9,4,0,15|t++22282++shadowflame,9482C9,5,0,15|t++17062++chaos_bolt,C41F3B,6,0,15|t++16093++shadowburn,9482C9,7,0,15|t++13443++incinerate,C41F3B,8,0,15|t++10858++soul_fire,C41F3B,9,0,15|t++4693++firebolt,C41F3B,10,0,15|t++4391++doombolt,9482C9,11,0,15|t++524++ebon_imp_melee,C79C6E,12,0,15&chtt=Warlock_Destruction_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:17,17,14,13,7,6,6,5,5,4,2,2,1,1,1,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,9482C9,C41F3B,C41F3B,9482C9,435133,9482C9,9482C9,9482C9,C79C6E,C41F3B&chl=firebolt|incinerate|immolate|conflagrate|soul_fire|shadowflame_dot|corruption|burning_embers|chaos_bolt|bane_of_doom|fel_flame|doombolt|shadowburn|shadowflame|ebon_imp_melee|darkmoon_card_volcano&chtt=Warlock_Destruction_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s864433yvyzy000zzywwvuvvwwxxvvtssrqqppqqqqstrqqppppqrrrrssrrrrrqpqqqrrrppoooooooooooonmnoonnnnnnnnmnnnnooooooonnnnnmmnmmnmlkkjiihhhhhijjjjjjiihhhhiiijjjjjjijiiiiiiiiihhhgggggggggffffeeeddddddddeeeeeffffeeeddddddddddddcccbbbabbbbbbbaaaaaaaaaaaaZZZZZZYYYYYYYYYYXXXXXXXXXXXXXXWWWVVVVVWWWWWWXXXXXXXXXXWWXWWWWWWWWWVVVVVVUUVUUVVVVVVVVVVVVWWWWWXXXXXXXXXXXXXXWWWWWWWWWWWWVVVUUUUUTTUUUUVVWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVWWWWWWWWXXXXYYYYYYYYYYYYZZZZZZZZYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105770&chtt=Warlock_Destruction_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bjklmoqrtxw01124457876222210zxssrqqqqppoonoonnnkkjjjkkmlkjjhhhhhhgfeffgggfdccdeffedeeeeffffeeffghhhiiiijiijjiiijjklllkjjiijjjjjjjjklllkjjjjjkkkjjjkkkkjjihhhhghhggggffeeeeedddeeefeeddddeeffffgghhhhgggggghhhhhhhhhhhhggggghiiijjjiijjjjjiijjkkkkkjjjjjjjjjjjjjiiihggggggggfffffffffffffgghhiiiihhhhhggggghgggffeeeeeeeeffgghhhhiijjkklllmmmmmmmllkkkjjjiiihhgggfffffffgggggggghhiijjkklllllkkkkjjjjjjjiihhgggfffeffffggggghhhhiijjkklllmlllllllllllkkkjjiiiiihihhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27629|max=47238&chxp=1,1,58,100&chtt=Warlock_Destruction_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,1,5,9,23,21,48,60,77,117,141,219,293,281,387,407,477,538,558,546,559,609,577,535,456,500,448,378,334,253,249,186,171,146,89,81,68,45,33,18,19,12,6,4,6,5,1,0,1&chds=0,609&chbh=5&chxt=x&chxl=0:|min=25982|avg=27629|max=29334&chxp=0,1,49,100&chtt=Warlock_Destruction_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Destruction_T11_372_PTR 27629
bane_of_doom 1238 4.5% 7.7 60.11sec 72414 63609 0 0 0 0.0% 1.6% 0.0% 0.0% 29 15235 31562 25.2% 0.0% 95.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.73 7.73 28.92 28.92 1.1384 15.0000 559635
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.40% 0.00 0 0 0
miss 0.1 1.60% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.6 74.80% 15235.25 12415 20823 329593
crit 7.3 25.20% 31561.89 25512 42703 230042

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
burning_embers 1399 5.1% 330.9 1.36sec 1912 0 0 0 0 24.6% 1.5% 0.0% 0.0% 448 1413 0 0.0% 0.0% 99.1%

Stats details: burning_embers

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
330.88 330.88 447.95 447.95 0.0000 1.0000 632790
Direct Results Count Pct Average Min Max Total Damage
hit 244.3 73.84% 0.00 0 0 0
crit 81.5 24.63% 0.00 0 0 0
miss 5.1 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 448.0 100.00% 1412.63 260 2158 632790

Action details: burning_embers

Static Values
  • id:85421
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:Your Soulfire and your Imp's Firebolt cause a Burning Ember damage-over-time effect on the target equal to a percentage of the damage done lasting $85421d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1243.88
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
chaos_bolt 1375 5.0% 31.1 14.57sec 19993 17062 15310 32158 43911 29.7% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.09 30.95 0.00 0.00 1.1718 0.0000 621599
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 68.74% 15309.56 12101 22123 325663
crit 9.2 29.74% 32157.88 26358 43911 295936
miss 0.5 1.53% 0.00 0 0 0

Action details: chaos_bolt

Static Values
  • id:50796
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a bolt of chaotic fire at the enemy, dealing $s1 Fire damage. Chaos Bolt cannot be resisted, and pierces through all absorption effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1311.57
  • base_dd_max:1665.89
conflagrate 3635 13.2% 51.9 8.76sec 31680 27690 22595 46534 75118 39.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.89 51.89 0.00 0.00 1.1441 0.0000 1643866
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 59.05% 22594.94 18563 36556 692350
crit 20.4 39.41% 46533.70 38144 75118 951517
miss 0.8 1.54% 0.00 0 0 0

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3288.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly deals fire damage equal to $s2% of your Immolate's periodic damage on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8739.10
  • base_dd_max:8739.10
corruption 1678 6.1% 25.2 18.12sec 30090 26369 0 0 0 0.0% 1.5% 0.0% 0.0% 199 2999 6216 25.1% 0.0% 98.3%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.22 25.22 199.40 199.40 1.1411 2.2298 758839
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 98.50% 0.00 0 0 0
miss 0.4 1.50% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 149.4 74.93% 2999.28 2430 4270 448139
crit 50.0 25.07% 6215.81 4993 8775 310700

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 109 0.4% 10.3 45.95sec 4802 0 4243 6562 7595 26.9% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.26 10.26 0.00 0.00 0.0000 0.0000 49291
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 71.63% 4243.06 3817 4916 31193
crit 2.8 26.87% 6561.81 5898 7595 18098
miss 0.2 1.50% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 505 1.8% 7.4 37.46sec 30740 26886 24712 51157 75577 24.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.42 7.41 0.00 0.00 1.1433 0.0000 228243
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 73.90% 24711.79 20160 36780 135230
crit 1.8 24.55% 51156.64 41425 75577 93013
miss 0.1 1.55% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
immolate 3834 13.9% 26.9 16.95sec 64550 55131 6368 13330 18657 30.7% 1.5% 0.0% 0.0% 199 5635 11832 31.1% 0.0% 98.8%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.86 26.86 199.46 199.46 1.1708 2.2404 1734028
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 67.85% 6368.37 5370 9080 116071
crit 8.2 30.66% 13330.15 11035 18657 109791
miss 0.4 1.49% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 137.5 68.92% 5635.25 4725 8142 774605
crit 62.0 31.08% 11831.91 9709 16731 733561

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 4637 16.8% 119.9 3.68sec 17496 13443 13377 28316 40966 29.5% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
119.86 119.33 0.00 0.00 1.3015 0.0000 2097123
Direct Results Count Pct Average Min Max Total Damage
hit 82.3 68.99% 13376.88 11099 19936 1101199
crit 35.2 29.48% 28315.73 22806 40966 995924
miss 1.8 1.54% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
shadowburn 222 0.8% 5.4 17.51sec 18681 16093 14852 30782 42938 25.5% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.38 5.38 0.00 0.00 1.1608 0.0000 100536
Direct Results Count Pct Average Min Max Total Damage
hit 3.9 72.98% 14851.59 11832 20896 58334
crit 1.4 25.48% 30781.65 24313 42938 42202
miss 0.1 1.54% 0.00 0 0 0

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly blasts the target for $17877s2 Shadow damage. If the target dies within $29341d of Shadowburn, and yields experience or honor, the caster gains $29341s1 Soul Shards. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.056000
  • base_dd_min:649.32
  • base_dd_max:724.90
shadowflame 1899 6.9% 33.7 13.48sec 25517 22282 2163 4467 5712 24.7% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.66 33.66 0.00 0.00 1.1452 0.0000 90805
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 73.80% 2162.88 1848 2858 53730
crit 8.3 24.66% 4466.93 3797 5712 37075
miss 0.5 1.54% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1699 6.1% 33.7 13.48sec 22819 0 0 0 0 24.7% 1.5% 0.0% 0.0% 134 4502 9340 25.1% 0.0% 44.5%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.66 33.66 134.38 134.38 0.0000 1.4989 768112
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 73.74% 0.00 0 0 0
crit 8.3 24.73% 0.00 0 0 0
miss 0.5 1.52% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.7 74.91% 4502.15 3646 6646 453200
crit 33.7 25.09% 9340.32 7493 13658 314912

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1806 6.5% 39.1 11.44sec 20893 10858 16017 33504 46361 29.7% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.10 38.95 0.00 0.00 1.9243 0.0000 816861
Direct Results Count Pct Average Min Max Total Damage
hit 26.8 68.74% 16016.92 13667 22562 428834
crit 11.6 29.73% 33504.32 28083 46361 388027
miss 0.6 1.53% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 45.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
pet - imp 4690
firebolt 4690 100.0% 300.1 1.51sec 7063 4693 5698 11475 17133 26.3% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
300.14 298.48 0.00 0.00 1.5051 0.0000 2119945
Direct Results Count Pct Average Min Max Total Damage
hit 214.1 71.72% 5697.53 4983 8588 1219660
crit 78.5 26.29% 11474.73 9942 17133 900286
miss 6.0 1.99% 0.00 0 0 0

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:632.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${$*$} Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.649000
  • base_dd_min:111.86
  • base_dd_max:124.88
pet - doomguard 3663
doombolt 3663 100.0% 21.0 2.08sec 9129 4391 7637 15562 20819 26.5% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.0790 0.0000 191719
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 71.60% 7636.66 6599 10436 109352
crit 5.3 26.46% 15561.99 13164 20819 82367
miss 0.4 1.94% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 204
ebon_imp_melee 204 100.0% 102.2 0.77sec 792 524 822 1644 1644 16.9% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.15 102.15 0.00 0.00 1.5120 0.0000 80924
Direct Results Count Pct Average Min Max Total Damage
hit 45.5 44.53% 822.05 822 822 37398
crit 17.2 16.88% 1644.11 1644 1644 28345
glance 24.6 24.10% 616.54 617 617 15181
dodge 6.6 6.51% 0.00 0 0 0
miss 8.1 7.98% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Destruction_T11_372_PTR
bane_of_doom mana 2.5% 23.5 3082
chaos_bolt mana 4.7% 13.9 1438
conflagrate mana 17.8% 9.6 3288
corruption mana 3.2% 24.4 1233
demon_soul mana 1.1% 0.0 2368
fel_flame mana 1.0% 24.9 1233
immolate mana 4.6% 39.3 1644
incinerate mana 36.0% 6.1 2877
shadowburn mana 1.7% 6.1 3082
shadowflame mana 18.1% 5.0 5138
soul_fire mana 7.6% 11.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - imp
firebolt mana 100.0% 11.2 632
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.3 29396.2 16.2 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 99773.0 99773.0 0.0%
life_tap mana 0.6 16977.3 27480.2 0.0%
mana_feed mana 78.5 364940.5 4651.4 0.2%
mp5_regen mana 1809.3 92595.4 51.2 0.3%
replenishment mana 1809.3 52241.2 28.9 0.3%
soul_leech mana 74.1 343519.5 4634.1 0.2%
pet - imp mana
initial_mana none 1.0 74771.7 74771.7 0.0%
mana_feed mana 0.6 68.0 110.1 99.3%
mana_spring_totem mana 1809.3 8154.8 4.5 72.4%
mp5_regen mana 1809.3 171562.0 94.8 65.7%
replenishment mana 1809.3 9788.1 5.4 72.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 33.7 17.3 13.5sec 8.9sec 81% 84%

Database details

  • id:54277
  • cooldown name:buff_backdraft
  • tooltip:Reduced cast time for your Shadow Bolt, Incinerate and Chaos Bolt by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bell_of_enraging_resonance 4.8 0.0 103.8sec 103.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 204.7 0.0 2.2sec 2.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.3 0.0 46.0sec 46.0sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_imp 4.3 0.0 120.7sec 120.7sec 19% 17%

Database details

  • id:79459
  • cooldown name:buff_demon_soul_imp
  • tooltip:Critical strike chance of your cast time Destruction spells increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
empowered_imp 11.3 0.4 36.2sec 35.0sec 5% 7%

Database details

  • id:47283
  • cooldown name:buff_empowered_imp
  • tooltip:Soulfire is instant cast.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:4.00%
improved_soul_fire 7.3 31.1 61.0sec 11.6sec 95% 94%

Database details

  • id:85383
  • cooldown name:buff_improved_soul_fire
  • tooltip:Shadow and Fire damage increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.6sec 46.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 45.7sec 45.7sec 0% 2%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain$?s86664[ Seed of Corruption][]
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.2 86.5sec 80.9sec 6% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.3sec 363.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
imp-bloodlust 1.0 0.0 0.0sec 0.1sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
imp-casting 301.1 0.0 1.5sec 1.5sec 95% 95%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $w1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $w1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 15.5%
backdraft_1 21.8%
backdraft_2 29.6%
backdraft_3 33.1%

Procs

Count Interval
ebon_imp 5.8 63.7sec
empowered_imp 11.7 35.0sec

Statistics & Data Analysis

DPS
Population
Convergence 67.88%
σ of the average dps 4.7483
2 * σ / μ 0.0344%
95% Confidence Intervall ( μ ± 2σ ) ( 27619.41 - 27638.40 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27614.66 - 27643.15 )
Sample Data
σ 474.8305
Minimum 25981.53
Maximum 29334.19
Spread ( max - min ) 3352.66
Range ( max - min ) / 2 1676.33
Range% 6.07
10th Percentile 26915.61
90th Percentile 28096.79
( 90th Percentile - 10th Percentile ) 1181.18
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1181
0.1 scale factor error with delta=300 2004
0.05 scale factor error with delta=300 8016
0.01 scale factor error with delta=300 200412
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_imp
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 soulburn,if=buff.bloodlust.down
A soul_fire,if=buff.soulburn.up
B fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
C immolate,if=(remains<cast_time+gcd|!ticking)&target.time_to_die>=4&miss_react
D conflagrate
E bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
F corruption,if=(!ticking|dot.corruption.remains<tick_time)&miss_react
G shadowflame
H soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
I chaos_bolt
J summon_doomguard
K soulburn,if=buff.bloodlust.down
L soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
M shadowburn
N incinerate
O life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
P fel_flame,moving=1
Q life_tap

Sample Sequence

01234678CDEFGIJLNDNNNCNGNDFILBBNNDBBGNNILDFN9ANCGNDINNLNDFGCNINDELNNGDNFCHINDNNGN9ALDCFINNGDHLNNNDCICFGLDNNNN68IDCEGLF9ADNNINGNCDLFNINDGNNNCLDINNFGNDNLCINDGNNNFEDEICLGDNNNNNDFICGLDNNNNNDFCFGILDNNNNNDCFG68HINDNENNNGCDIFHLNDNBGNBIDLNFNCDGHINNNDNNNGCFDILNNNDEGNNBBDFILCGDNHNHNIDFGNNCLDNHINGNDFNCLNDGI68NNNNDECFGILDNNNNNCDFGILNDNNNNCGDIFLNNDNNGNCIDNLFNNGDEQNCIL7DMGNFNNDILCNGDMNNNIFDLCGNMDNINLND68FCGNMIDELNNNDCFGIMLDNLNNGCDFIMNLDBGNNBIDNFLMCDGN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5730 5048 4639
Spirit 197 197 20
Health 152668 128504 0
Mana 105623 95993 0
Spell Power 9422 7245 2207
Spell Hit 15.47% 15.47% 1585
Spell Crit 20.66% 14.61% 919
Spell Haste 30.05% 20.25% 2593
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 13.20% 13.20% 1585
Melee Crit 16.14% 8.19% 919
Melee Haste 20.25% 20.25% 2593
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.97% 12.97% 891

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 3
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 2
Backdraft 3
Shadowburn 1
Burning Embers 2
Soul Leech 2
Backlash 0
Nether Ward 1
Fire and Brimstone 3
Shadowfury 1
Nether Protection 2
Empowered Imp 2
Bane of Havoc 1
Chaos Bolt 1

Profile

#!./simc

warlock=Warlock_Destruction_T11_372_PTR
origin="http://chardev.org/?profile=36761"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
glyphs=life_tap/immolate/imp/conflagrate
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_imp
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.soulburn.up
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
actions+=/immolate,if=(remains=4&miss_react
actions+=/conflagrate
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/corruption,if=(!ticking|dot.corruption.remains actions+=/shadowflame
actions+=/soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
actions+=/chaos_bolt
actions+=/summon_doomguard
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
actions+=/shadowburn
actions+=/incinerate
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4639
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1585
# gear_crit_rating=919
# gear_haste_rating=2593
# gear_mastery_rating=891
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warrior_Arms_T11_372 : 28010dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28009.7 16.43 / 0.06% 2801.2 10.0 10.1 rage 10.28% 48.7
Origin http://chardev.org/?profile=36399
Talents http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
Glyphs
  • thunder_clap
  • cleaving
  • sweeping_strikes
  • battle
  • berserker_rage
  • intimidating_shout
  • slam
  • overpower
  • mortal_strike

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:31723|24527|17867|16582|8945|3257&chds=0,63445&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31723++overpower,C79C6E,0,0,15|t++24527++execute,C79C6E,1,0,15|t++17867++mortal_strike,C79C6E,2,0,15|t++16582++slam,C79C6E,3,0,15|t++8945++colossus_smash,C79C6E,4,0,15|t++3257++melee_main_hand,C79C6E,5,0,15&chtt=Warrior_Arms_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:21,19,11,10,10,8,7,5,5,4&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E&chl=overpower|mortal_strike|slam_mh|opportunity_strike|melee_main_hand|deep_wounds|execute|rend_dot|heroic_strike|colossus_smash&chtt=Warrior_Arms_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bgbhbhlq4457875vqjljcaaaZWXYYXUXaZYWXaZYVXZXUTSTSQSRQPPQQPQPQVWXYWXYXXXVVVUVUTSTTSRSQRSQQQPRSRRQPRRPQPPQQPPOPPQQPPOPQPPPPQSSUWXadgimpsuurpmljhedcbbaYYYXXXXXWWWVUUTUTTTSSSSRRQQRRQQPPQRRSSSTTSRSRRSRRRQRRQQQQRRQRRRRSSSTTTUTSTSSTTSSSSSSRRRRRRRQQRRRRSTVWYacfiklmllkjhfedcbaZXXXXWWVVWWVVUTUUUTTTTTTTTSTTSSSRSSRRSSTUTUUUUUSSSRRSRQRQQRQQQQQRRQRRSSSRRRSSSSSSSSSSSSSSSSSSSSRSSSTTTUUVWXXYZZaZZYZYYXXWWWWWVVVVVVVUVVUUTTUTTTTSTTTSSRSSSSRRSSSSSSTTSSRRSSSRRRSSSSRRSTS&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Warrior_Arms_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:345455765556677775123zxvvvurqrrqqpooooonlllllkiiiihgffffffeeefffeeffffeffggffffggfeeffffeeefffeeffffeefgggffgghggghijjjjklmllmmoonnnopoonnnnnnmmmmmllkllllkkllllkjkkkjiiiiihgggggfeeffffeeefffeeefffeeefffeeffffffgghggghiihhhijjiiiijjihhiiiihhijjiiijkkkjjklllkkkllkkkkllkjjkkkkjjkllkkkkkkkjjjjjiihiiihhhhiihhhiijiiijkkkjjklllkkllmlllmmmmmmmnnnmmmnnnmmmmmmmmmmmmmlmmmmmmmmnnnnnnoonoooooooppqqqqrrssssttuuuuvvvvvvvvvuuuttttttsttttttttuuuuuuvvvvvvvvvvvvvvvvv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28010|max=44163&chxp=1,1,63,100&chtt=Warrior_Arms_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,5,3,6,12,31,32,59,77,120,171,205,268,328,421,474,603,609,672,643,681,616,621,602,558,456,388,318,267,216,160,109,80,72,39,26,17,7,10,5,4,2,1,0,2,0,0,0,0,2&chds=0,681&chbh=5&chxt=x&chxl=0:|min=25157|avg=28010|max=32146&chxp=0,1,41,100&chtt=Warrior_Arms_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Arms_T11_372 28010
battle_shout 0 0.0% 5.8 70.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.83 5.83 0.00 0.00 1.5155 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.8 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 15.2 30.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.16 15.16 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
colossus_smash 1100 3.9% 36.7 12.38sec 13553 8945 11253 23708 40961 21.5% 3.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.68 36.68 0.00 0.00 1.5152 0.0000 497158
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 75.15% 11253.08 8906 19884 310205
crit 7.9 21.50% 23708.20 18546 40961 186953
dodge 1.2 3.36% 0.00 0 0 0

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
deadly_calm 0 0.0% 3.5 127.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.53 3.53 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:-0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Abilities cost no rage.
  • description:For the next $d, none of your abilities cost rage, but you continue to generate rage. Cannot be used during Inner Rage.
deep_wounds 2256 8.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 432 2360 0 0.0% 0.0% 95.6%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 173.73 432.23 432.23 0.0000 1.0000 1020256
Direct Results Count Pct Average Min Max Total Damage
hit 173.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 432.2 100.00% 2360.43 770 9740 1020256

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2251.10
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 2091 7.5% 25.5 3.47sec 37051 24527 30666 57810 135706 27.2% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.52 25.52 0.00 0.00 1.5106 0.0000 945664
Direct Results Count Pct Average Min Max Total Damage
hit 17.7 69.45% 30665.73 464 65877 543599
crit 7.0 27.25% 57810.31 38 135706 402065
dodge 0.8 3.30% 0.00 0 0 0

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 1400 5.0% 36.4 12.13sec 17391 0 12633 27489 50061 34.9% 3.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.39 36.39 0.00 0.00 0.0000 0.0000 632925
Direct Results Count Pct Average Min Max Total Damage
hit 22.4 61.68% 12632.73 8287 23197 283576
crit 12.7 34.92% 27488.79 17409 50061 349350
dodge 1.2 3.40% 0.00 0 0 0

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 2706 9.7% 125.1 3.63sec 9778 3257 8864 18257 31201 18.5% 3.3% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.13 125.13 0.00 0.00 3.0023 0.0000 1223535
Direct Results Count Pct Average Min Max Total Damage
hit 67.8 54.22% 8864.35 6352 15146 601369
crit 23.2 18.52% 18257.47 13162 31201 423059
glance 29.9 23.92% 6651.40 4764 10843 199107
dodge 4.2 3.34% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 5344 19.1% 88.8 5.10sec 27210 17867 20083 45748 74735 30.4% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.80 88.80 0.00 0.00 1.5229 0.0000 2416336
Direct Results Count Pct Average Min Max Total Damage
hit 58.9 66.29% 20082.83 12272 32894 1182230
crit 27.0 30.38% 45748.48 27881 74735 1234107
dodge 3.0 3.33% 0.00 0 0 0

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:Healing effects received reduced by $w1%.
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and wounds the target, reducing the effectiveness of any healing received for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:423.09
  • base_dd_max:423.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
opportunity_strike 2740 9.8% 129.0 3.50sec 9608 0 7998 16879 28223 21.1% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
128.95 128.95 0.00 0.00 0.0000 0.0000 1238988
Direct Results Count Pct Average Min Max Total Damage
hit 97.5 75.57% 7998.36 5822 13078 779447
crit 27.2 21.11% 16878.96 12060 28223 459542
dodge 4.3 3.32% 0.00 0 0 0

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
overpower 5817 20.8% 81.6 5.49sec 32227 31723 15933 36526 58716 79.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.62 81.62 0.00 0.00 1.0159 0.0000 2630280
Direct Results Count Pct Average Min Max Total Damage
hit 17.0 20.88% 15933.25 8785 25843 271512
crit 64.6 79.12% 36526.26 19960 58716 2358768

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:5.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly overpower the enemy, causing $m1% weapon damage. Only useable after the target dodges. The Overpower cannot be blocked, dodged or parried.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
recklessness 0 0.0% 2.0 363.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
rend 1484 5.3% 1.2 210.68sec 568431 372368 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.18 1.18 0.00 0.00 1.5265 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.2 100.00% 0.00 0 0 0

Action details: rend

Static Values
  • id:772
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Wounds the target causing them to bleed for $94009o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $94009d.
rend_dot 1484 5.3% 1.2 210.68sec 568431 0 0 0 0 0.0% 3.6% 0.0% 0.0% 150 3657 7564 21.2% 0.0% 98.6%

Stats details: rend_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.18 1.18 149.68 149.68 0.0000 2.9772 671203
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 96.40% 0.00 0 0 0
dodge 0.0 3.60% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 118.0 78.83% 3657.23 1358 5136 431499
crit 31.7 21.17% 7563.67 2798 10580 239704

Action details: rend_dot

Static Values
  • id:94009
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:Wounds the target causing them to bleed for $o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:2540.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slam 3071 11.0% 55.3 6.42sec 25104 16582 0 0 0 0.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.31 55.31 0.00 0.00 1.5139 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 53.5 96.70% 0.00 0 0 0
dodge 1.8 3.30% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 3071 11.0% 53.5 6.63sec 25959 0 19843 45256 74580 24.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
53.49 53.49 0.00 0.00 0.0000 0.0000 1388544
Direct Results Count Pct Average Min Max Total Damage
hit 40.6 75.93% 19842.79 12336 32826 805917
crit 12.9 24.07% 45256.44 29170 74580 582627

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Arms_T11_372
colossus_smash rage 14.8% 745.0 18
execute rage 14.5% 1441.6 26
heroic_strike rage 8.8% 1596.4 11
mortal_strike rage 36.0% 1484.5 18
overpower rage 8.3% 7007.8 5
rend rage 0.0% 503528.2 1
slam rage 16.8% 1825.1 14
Resource Gains Type Count rage Average Overflow
anger_management rage 1809.3 147.7 0.1 2.0%
avoided_attacks rage 5.9 91.9 15.5 0.0%
battle_shout rage 5.8 116.6 20.0 0.0%
berserker_rage rage 15.2 75.8 5.0 0.0%
blood_frenzy rage 12.0 229.4 19.1 4.7%
melee_main_hand rage 125.1 3781.0 30.2 2.1%
sudden_death rage 12.9 109.3 8.4 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 3.0 0.0 183.6sec 362.6sec 99% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 12.8 0.0 32.6sec 32.6sec 5% 7%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 15.2 0.0 30.8sec 30.8sec 33% 33%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance 2.0 0.0 365.3sec 365.3sec 1% 100%

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.3sec 123.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
colossus_smash 29.0 6.4 15.7sec 12.8sec 46% 40%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_calm 3.5 0.0 127.3sec 127.3sec 8% 6%

Database details

  • id:
  • cooldown name:buff_deadly_calm
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
executioner_talent 1.5 23.2 45.7sec 3.6sec 19% 41%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.3sec 339.3sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 3.2 0.0 105.9sec 105.9sec 2% 9%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
inner_rage 4.0 0.0 104.6sec 104.6sec 13% 13%

Database details

  • id:1134
  • cooldown name:buff_inner_rage
  • tooltip:Heroic Strike and Cleave cooldown reduced.
  • max_stacks:1
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
lambs_to_the_slaughter 1.1 84.8 254.8sec 5.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_lambs_to_the_slaughter
  • tooltip:(null)
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 14.3 24.7 31.9sec 11.4sec 64% 66%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overpower 14.2 0.4 30.7sec 29.8sec 4% 16%

Database details

  • id:
  • cooldown name:buff_overpower
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:1.00
  • default_chance:100.00%
recklessness 2.0 0.0 363.8sec 363.8sec 5% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
taste_for_blood 73.5 1.5 6.1sec 6.0sec 22% 90%

Database details

  • id:
  • cooldown name:buff_taste_for_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:9.00
  • cooldown:5.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 80.6 375.3sec 5.5sec 98% 97%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
wrecking_crew 13.7 13.2 33.5sec 16.6sec 56% 55%

Database details

  • id:
  • cooldown name:buff_wrecking_crew
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 2.0%

Procs

Count Interval
munched_deep_wounds 31.0 14.8sec
rolled_deep_wounds 31.0 15.2sec
strikes_of_opportunity 129.0 3.5sec
sudden_death 33.9 13.3sec

Statistics & Data Analysis

DPS
Population
Convergence 70.87%
σ of the average dps 8.2145
2 * σ / μ 0.0587%
95% Confidence Intervall ( μ ± 2σ ) ( 27993.30 - 28026.15 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27985.08 - 28034.37 )
Sample Data
σ 821.4510
Minimum 25157.13
Maximum 32145.60
Spread ( max - min ) 6988.47
Range ( max - min ) / 2 3494.24
Range% 12.48
10th Percentile 26979.49
90th Percentile 29081.87
( 90th Percentile - 10th Percentile ) 2102.38
Approx. Iterations needed for
1% dps error 34
0.1% dps error 3440
0.1 scale factor error with delta=300 5998
0.05 scale factor error with delta=300 23992
0.01 scale factor error with delta=300 599805
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
6 stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
7 recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
8 berserker_rage,if=!buff.deadly_calm.up&rage<70
9 deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
A sweeping_strikes,if=target.adds>0
B bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
C cleave,if=target.adds>0
D inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
E heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
F overpower,if=buff.taste_for_blood.remains<=1.5
G mortal_strike,if=target.health_pct>20|rage>=30
H execute,if=buff.battle_trance.up
I rend,if=!ticking
J colossus_smash,if=buff.colossus_smash.remains<0.5
K execute,if=(buff.deadly_calm.up|buff.recklessness.up)
L mortal_strike
M overpower
N execute
O slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
P battle_shout,if=rage<20

Sample Sequence

013458P7E69GIEJGEMOMEGDJDEOGMJGMOJGMO8GEOMGOMGDEOJGMOJGMOJGMO8GEMOGOMPGOMJGOMJGOMGO8MGOJMGEOMGOGJMFGMOGEO89MGEOJEGMODEGEMOGJMGFOMDEGOPG8MOGMJGDEOMGJMEGOJGMOMF8GJMGEOJMGOGMOGOMJPGME8JGMOGMGOMGJOGEMOG9EMGEOJEGMODE8GMJGMOGOMGEOGMOJGMPJ8GMOJGMOJFGMOGOMGJMFGO8MGEOGMGFOJGMMGEOMGEOG8MOJGMOPGMOFGO9EMGEOJEGMODEG8EMOGOMGOMGEOJMGOMGOGM8OGMJEGOMJPEGOEJGMOJMGMJ8G57K6KKGKKGKMNGMJNGEMJNGMJ8NGMJNLMJNGMNNNGMNNNGEMN8JGMFNGEJMNENMGNNGMNNGEMNN8GJMNGMNJGNMJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6261 4977 4548
Agility 729 145 20
Stamina 7658 6035 5862
Intellect 55 53 20
Spirit 82 82 20
Health 150167 127515 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.59% 9.59% 982
Spell Crit 20.36% 15.36% 2575
Spell Haste 11.23% 5.93% 760
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14215 10354 190
Melee Hit 8.18% 8.18% 982
Melee Crit 23.36% 15.96% 2575
Melee Haste 5.93% 5.93% 760
Expertise 12.69 12.69 381
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.02% 15.02% 1259

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 2
Taste for Blood 3
Sweeping Strikes 1
Impale 2
Improved Hamstring 0
Improved Slam 2
Deadly Calm 1
Blood Frenzy 2
Lambs to the Slaughter 3
Juggernaut 1
Sudden Death 2
Wrecking Crew 2
Throwdown 1
Bladestorm 1
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 0
Rude Interruption 0
Piercing Howl 0
Flurry 0
Death Wish 0
Enrage 0
Die by the Sword 0
Raging Blow 0
Rampage 0
Heroic Fury 0
Furious Attacks 0
Meat Cleaver 0
Intensify Rage 0
Bloodsurge 0
Skirmisher 0
Titan's Grip 0
Single-Minded Fury 0
Protection Rank
Incite 1
Toughness 0
Blood and Thunder 2
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Arms_T11_372
origin="http://chardev.org/?profile=36399"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
glyphs=thunder_clap/cleaving/sweeping_strikes/battle/berserker_rage/intimidating_shout/slam/overpower/mortal_strike
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
actions+=/recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/berserker_rage,if=!buff.deadly_calm.up&rage<70
actions+=/deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
actions+=/sweeping_strikes,if=target.adds>0
actions+=/bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
actions+=/cleave,if=target.adds>0
actions+=/inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
actions+=/heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
actions+=/overpower,if=buff.taste_for_blood.remains<=1.5
actions+=/mortal_strike,if=target.health_pct>20|rage>=30
actions+=/execute,if=buff.battle_trance.up
actions+=/rend,if=!ticking
actions+=/colossus_smash,if=buff.colossus_smash.remains<0.5
actions+=/execute,if=(buff.deadly_calm.up|buff.recklessness.up)
actions+=/mortal_strike
actions+=/overpower
actions+=/execute
actions+=/slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
actions+=/battle_shout,if=rage<20
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4548
# gear_agility=20
# gear_stamina=5862
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=381
# gear_hit_rating=982
# gear_crit_rating=2575
# gear_haste_rating=760
# gear_mastery_rating=1259
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_1h_T11_372 : 28523dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28522.6 18.28 / 0.06% 2261.4 12.6 12.7 rage 8.52% 46.0
Origin http://chardev.org/?profile=36557
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • battle
  • berserker_rage
  • bloody_healing
  • slam
  • raging_blow
  • bloodthirst

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:24043|20323|18952|13299|7039|5145|3196&chds=0,48085&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++24043++execute,C79C6E,0,0,15|t++20323++bloodthirst,C79C6E,1,0,15|t++18952++slam,C79C6E,2,0,15|t++13299++raging_blow,C79C6E,3,0,15|t++7039++colossus_smash,C79C6E,4,0,15|t++5145++melee_main_hand,C79C6E,5,0,15|t++3196++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:32,18,11,10,6,5,5,4,3,3,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|melee_off_hand|heroic_strike|deep_wounds|execute|slam_mh|raging_blow_mh|slam_oh|raging_blow_oh|colossus_smash&chtt=Warrior_Fury_1h_T11_372+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:cpoYafYenkotquzwz1z1312upmljjnw144667767643yrleeeafggjlknompsrvwsojceebgkknporsrttsuurohbcbZdghklmopqstuvvtpjedccehiklmoppqrsttrniecccehjlnoprrsronookgcaaabeghjklnoprrssrnjfcccehjlnnoqqrstttsokfdccegikmnopqrstttspkgdccdfhjlmopqrstttrokgecdegikmnoqrsstttrokgedcdfhjlmnpqrstttrplhedcefhjlmoomklmnonliecbbbdegijklmnopppomjgedcdeghjklmnopqqqpoligfeefhiklmnoopqqqqomjhgffghiklmnoopqqqpomkhgffghijklmnnoppppomkihgghhijklmnnopppponlkiihhhijjhhijkllmnnmmlkjjjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Warrior_Fury_1h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:84552331220223101zyzwvvututssrqrqppolmkjjihhhggfeedccbbbabbaaaaaaaaaaaaabbabaabaaaaaaaaaaaaaaaaabbbbcccddddeeeffffgggggggfffffeeeeddddddddddeeffgghhiiijjkkllllllkkkjiihhggffeeddcccbbbbaaaaaaaaaaaaaaabbbbbcccddddeeeeffffffggggfffffffffffgggggggggggggggffeeedddccccccccddeeeffffggggghhhhhhgggggggfffffffffffgggggggggghhhhhhhhhhhhgggggggggffffffeeeeeeddddddddddccccccccccccccccccccccddddddeeefffgghhiiijjjkkkkkkkkjjjjjjjjjjjjjjjjjkkkllllmmmmmmmnnnnnooooop&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28523|max=52003&chxp=1,1,55,100&chtt=Warrior_Fury_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,0,2,2,6,5,11,12,30,42,48,79,94,141,195,226,267,329,426,437,550,588,591,595,650,596,634,557,528,463,384,341,272,219,175,136,116,82,58,39,27,17,11,5,3,3,4,1,1&chds=0,650&chbh=5&chxt=x&chxl=0:|min=24843|avg=28523|max=32072&chxp=0,1,51,100&chtt=Warrior_Fury_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T11_372 28523
battle_shout 0 0.0% 12.3 37.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.26 12.26 0.00 0.00 1.5149 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.3 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 6.9 55.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.92 6.92 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 9193 32.2% 134.8 3.34sec 30839 20323 22665 47210 101622 33.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.81 134.81 0.00 0.00 1.5174 0.0000 4157307
Direct Results Count Pct Average Min Max Total Damage
hit 89.9 66.70% 22664.96 14404 49331 2037929
crit 44.9 33.30% 47210.48 29672 101622 2119378

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore $?s84580[${$m2/1000*1.2}.1]?s84579[${$m2/1000*1.1}.2][${$m2/1000}.1]% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 515 1.8% 21.9 21.10sec 10647 7039 8477 17657 26651 23.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.88 21.88 0.00 0.00 1.5125 0.0000 232939
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 76.36% 8476.85 6477 12938 141608
crit 5.2 23.64% 17656.56 13343 26651 91330

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage dealt by $w1%.$?$w3!=0[ Increases all damage taken by $w3%.][]
  • description:When activated you become Enraged, increasing your physical damage by $s1%$?s94374[][but increasing all damage taken by $s3%]. Lasts $d.
deep_wounds 1612 5.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 433 1682 0 0.0% 0.0% 95.8%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 209.85 433.38 433.38 0.0000 1.0000 729015
Direct Results Count Pct Average Min Max Total Damage
hit 209.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 433.4 100.00% 1682.14 302 7134 729015

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1495.02
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1567 5.5% 19.5 4.59sec 36322 24043 29455 60399 129276 22.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.51 19.51 0.00 0.00 1.5108 0.0000 708583
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 77.81% 29454.90 4437 62755 447087
crit 4.3 22.19% 60398.76 12882 129276 261496

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2772 9.7% 55.3 8.01sec 22685 0 15472 31791 66283 44.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.26 55.26 0.00 0.00 0.0000 0.0000 1253484
Direct Results Count Pct Average Min Max Total Damage
hit 30.8 55.80% 15472.15 9399 32176 477037
crit 24.4 44.20% 31791.36 19362 66283 776447

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 5139 18.0% 261.9 1.73sec 8872 5145 9159 18873 36454 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.92 261.92 0.00 0.00 1.7245 0.0000 2323833
Direct Results Count Pct Average Min Max Total Damage
hit 96.5 36.83% 9158.95 6173 17696 883600
crit 53.4 20.41% 18872.55 12715 36454 1008623
glance 62.8 23.98% 6872.33 4629 13272 431611
miss 49.2 18.78% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3193 11.2% 261.3 1.73sec 5526 3196 5710 11761 22784 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.27 261.27 0.00 0.00 1.7288 0.0000 1443695
Direct Results Count Pct Average Min Max Total Damage
hit 96.2 36.82% 5709.82 3858 11060 549324
crit 53.2 20.37% 11761.40 7947 22784 625834
glance 62.7 23.99% 4283.42 2893 8295 268537
miss 49.2 18.82% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 2053 7.2% 46.0 9.50sec 20165 13299 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.05 46.05 0.00 0.00 1.5163 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 1262 4.4% 46.0 9.50sec 12389 0 9415 19768 38386 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.05 46.05 0.00 0.00 0.0000 0.0000 570487
Direct Results Count Pct Average Min Max Total Damage
hit 32.8 71.28% 9415.11 6568 18634 309022
crit 13.2 28.72% 19768.29 13530 38386 261465

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 792 2.8% 46.0 9.50sec 7776 0 5911 12396 23991 28.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.05 46.05 0.00 0.00 0.0000 0.0000 358079
Direct Results Count Pct Average Min Max Total Damage
hit 32.8 71.24% 5911.14 4105 11646 193922
crit 13.2 28.76% 12396.49 8456 23991 164157

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
slam 2479 8.7% 39.1 11.25sec 28638 18952 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.14 39.14 0.00 0.00 1.5111 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 39.1 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1492 5.2% 39.1 11.25sec 17236 0 13206 27367 52475 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.14 39.14 0.00 0.00 0.0000 0.0000 674606
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.54% 13205.74 9332 25473 369741
crit 11.1 28.46% 27367.22 19224 52475 304865

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45
slam_oh 987 3.5% 39.1 11.25sec 11402 0 8738 18091 34116 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.14 39.14 0.00 0.00 0.0000 0.0000 446242
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.52% 8738.42 6191 16561 244616
crit 11.1 28.48% 18091.00 12753 34116 201626

Action details: slam_oh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_1h_T11_372
bloodthirst rage 47.3% 1541.9 20
colossus_smash rage 7.5% 541.4 20
death_wish rage 0.5% 0.0 7
execute rage 9.8% 1264.6 29
heroic_strike rage 19.4% 1131.3 20
raging_blow rage 15.5% 1051.5 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.3 367.8 30.0 0.0%
berserker_rage rage 6.9 47.1 6.8 0.3%
melee_main_hand rage 212.7 3557.5 16.7 1.0%
melee_off_hand rage 212.1 1780.2 8.4 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 20.2 0.0 21.3sec 21.3sec 8% 8%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 6.9 0.0 55.2sec 55.2sec 15% 15%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.0sec 123.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 39.4 1.1 11.3sec 11.0sec 16% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 14.6 41.8 29.2sec 7.4sec 58% 56%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 18.5 45.8sec 4.6sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 77.6 152.3 5.8sec 2.0sec 70% 69%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.2sec 339.2sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 104.8sec 104.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.1 0.0 40.9sec 40.9sec 10% 16%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 13.5 13.0 33.2sec 16.5sec 50% 51%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.5 46.2sec 32.7sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.7 44.4 364.7sec 9.5sec 96% 95%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.8%

Procs

Count Interval
munched_deep_wounds 47.8 9.7sec
rolled_deep_wounds 35.2 13.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.02%
σ of the average dps 9.1408
2 * σ / μ 0.0641%
95% Confidence Intervall ( μ ± 2σ ) ( 28504.28 - 28540.84 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28495.14 - 28549.99 )
Sample Data
σ 914.0767
Minimum 24843.32
Maximum 32071.85
Spread ( max - min ) 7228.53
Range ( max - min ) / 2 3614.26
Range% 12.67
10th Percentile 27366.43
90th Percentile 29699.23
( 90th Percentile - 10th Percentile ) 2332.80
Approx. Iterations needed for
1% dps error 41
0.1% dps error 4108
0.1 scale factor error with delta=300 7426
0.05 scale factor error with delta=300 29707
0.01 scale factor error with delta=300 742698
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F slam,if=buff.bloodsurge.react
G execute,if=rage>=50
H berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
I raging_blow
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEIEFAEFAEIEAEIAECAEIEFEFEAIEFAECAEHIAEJEIAEAEIEECAEIEAEHIEEIEJCAEIAEEIEEHIEFECEFAEIEFEIEAJEAIECAFEIEEFEIEF7ECEAIEFJEIEAEIECAEIEAEFEIEFEAIECAEFEIJAEFEFEIECAEHIAEEAIEFEFAEFECAEFEHIE6FEFAIEJAEFCAEFAEFEFEIEEAIECAEFEHIEJAEFEF7EIECAEIEEIEEIEJECAEIEEFEIEEIECAEIEFEIJEFAEFAECAEIAEAEIEAEFEFICAEFAEIEJAEIEAEIEFCEAHIEEFEFEIEFAJCAEIAEAEIE7EBDDDFCDEIEFBEIEJBEGCAEFAEBEAFEG6GEAIEAFBACEIEBEJGEFGEGECFEABEFGEAFEGEGECAEFABEIGEAGE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6222 4940 4513
Agility 729 145 20
Stamina 7572 5953 5780
Intellect 55 53 20
Spirit 82 82 20
Health 148963 126367 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 6.10% 6.10% 625
Spell Crit 20.20% 15.20% 2545
Spell Haste 13.93% 8.50% 1089
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14130 10280 190
Melee Hit 8.20% 8.20% 625
Melee Crit 23.19% 15.79% 2545
Melee Haste 8.50% 8.50% 1089
Expertise 26.64 26.64 800
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 6.51% 6.51% 809

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 0
Single-Minded Fury 1
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_1h_T11_372
origin="http://chardev.org/?profile=36557"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
glyphs=death_wish/cleaving/heroic_throw/battle/berserker_rage/bloody_healing/slam/raging_blow/bloodthirst
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands=plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4513
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=800
# gear_hit_rating=625
# gear_crit_rating=2545
# gear_haste_rating=1089
# gear_mastery_rating=809
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_2h_T11_372 : 28124dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28124.5 18.81 / 0.07% 2218.4 12.7 12.8 rage 8.52% 46.2
Origin http://chardev.org/?profile=36611
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • bloody_healing
  • battle
  • berserker_rage
  • bloodthirst
  • raging_blow
  • slam

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:21638|20921|18040|14360|9522|4981|3092&chds=0,43276&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++21638++raging_blow,C79C6E,0,0,15|t++20921++execute,C79C6E,1,0,15|t++18040++bloodthirst,C79C6E,2,0,15|t++14360++slam,C79C6E,3,0,15|t++9522++colossus_smash,C79C6E,4,0,15|t++4981++melee_main_hand,C79C6E,5,0,15|t++3092++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:28,18,11,9,9,7,6,6,4,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|melee_off_hand|raging_blow_mh|heroic_strike|deep_wounds|raging_blow_oh|slam_mh|execute|colossus_smash&chtt=Warrior_Fury_2h_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:forcdaYcojmkkpyuvtrx20yumlcffow1vx1685zz134xtlccZbhhiijkmommoortolgYaZagjjlllpqqqpprrplfZYYZdgghijmnoppqssqmgcaZbehiijkmnooopqqokfcZZbehijklnoppnkklkhdZXXYbefgghjlmmmnoonkfbYYadgijklmoooopqqolhdbabegijklmnopppqpnkgcaabdfhijkmooppqqqolhdbabdfhijkmnopppqpokhdbabdfhijkmnoppqqpolhdbabdfhijklmjhijjjigebZYZacefghijkkllllkifdbabcegghijklmnnoomkigeddefghijklmnoooonmjhfeeffhijklmnooppoomkigfeefghijklmnoopoomljhgffghijkllmnnoooonmkjhggghijjhghijkkllllkjihhhi&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=71&chtt=Warrior_Fury_2h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:7454223111z1121zzxxxvttsssrqqppponomkkjiihghgffeddcccbbbaaaaaaaaaaaaZaaZaaaaaZaaZaaaaaaaZZaZZaZaaaaaabbbbcccccdddeeeeeeeeeeeeeddddddcccccccdddeeffgghhiijjkkkkkkkkkkjiihhggffeeddcccbbaaaZZZZZZZZZZZZZaaaaaaabbbbbcccccdddddddeeeeeeedeeeeefffffggggggffffffeeedddccbbbbbbbccccddddeeeeffffggggggggfffffffffffffffffgffffffffffffffffeeeeeeeeeeeeeeddddddddddccccccccccccbbbbbbbbbbbbbbbbbbbbbbbbcccccdddeeeffgggghhhhhhhhhhhgggggggggggggghhhiiijjjkkkklllmmmnnnnoo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28124|max=53188&chxp=1,1,53,100&chtt=Warrior_Fury_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,2,3,2,9,7,9,17,13,37,37,71,82,121,176,229,260,289,381,443,552,506,603,653,624,655,616,532,505,487,440,347,279,259,193,154,115,87,74,33,27,22,22,8,6,5,3,3,1&chds=0,655&chbh=5&chxt=x&chxl=0:|min=24312|avg=28124|max=31703&chxp=0,1,52,100&chtt=Warrior_Fury_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T11_372 28124
battle_shout 0 0.0% 12.1 37.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.09 12.09 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 9.5 44.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.53 9.53 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.5 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 7998 28.4% 132.1 3.41sec 27369 18040 19965 41618 89842 34.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.14 132.14 0.00 0.00 1.5171 0.0000 3616473
Direct Results Count Pct Average Min Max Total Damage
hit 87.0 65.81% 19965.41 12557 43613 1736110
crit 45.2 34.19% 41617.90 25867 89842 1880363

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore $?s84580[${$m2/1000*1.2}.1]?s84579[${$m2/1000*1.1}.2][${$m2/1000}.1]% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 697 2.5% 21.9 21.11sec 14410 9522 11386 23712 35077 24.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.87 21.87 0.00 0.00 1.5134 0.0000 315101
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 75.47% 11386.36 8692 17028 187909
crit 5.4 24.53% 23712.21 17905 35077 127192

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage dealt by $w1%.$?$w3!=0[ Increases all damage taken by $w3%.][]
  • description:When activated you become Enraged, increasing your physical damage by $s1%$?s94374[][but increasing all damage taken by $s3%]. Lasts $d.
deep_wounds 2012 7.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 423 2152 0 0.0% 0.0% 93.5%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 183.03 422.71 422.71 0.0000 1.0000 909578
Direct Results Count Pct Average Min Max Total Damage
hit 183.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 422.7 100.00% 2151.78 429 10067 909578

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:545.98
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1150 4.1% 16.5 5.45sec 31590 20921 25464 52173 122786 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.46 16.46 0.00 0.00 1.5099 0.0000 519932
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 77.06% 25463.89 1038 59605 322979
crit 3.8 22.94% 52172.96 3184 122786 196953

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2404 8.5% 54.3 8.18sec 20019 0 13524 27902 58599 45.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.30 54.30 0.00 0.00 0.0000 0.0000 1086923
Direct Results Count Pct Average Min Max Total Damage
hit 29.8 54.83% 13523.83 8194 28446 402598
crit 24.5 45.17% 27902.27 16879 58599 684325

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4971 17.7% 176.7 2.57sec 12719 4981 12817 26410 50264 21.2% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.73 176.73 0.00 0.00 2.5537 0.0000 2247809
Direct Results Count Pct Average Min Max Total Damage
hit 66.4 37.56% 12817.45 8639 24400 850728
crit 37.5 21.21% 26409.66 17797 50264 989794
glance 42.4 23.98% 9609.07 6479 18300 407287
miss 30.5 17.25% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3086 11.0% 176.1 2.57sec 7925 3092 7993 16456 31415 21.2% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.07 176.07 0.00 0.00 2.5633 0.0000 1395360
Direct Results Count Pct Average Min Max Total Damage
hit 66.1 37.56% 7992.58 5400 15250 528616
crit 37.3 21.17% 16455.76 11123 31415 613502
glance 42.3 24.00% 5993.06 4050 11437 253242
miss 30.4 17.26% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 4241 15.1% 58.4 7.73sec 32825 21638 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.42 58.42 0.00 0.00 1.5170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 58.4 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 2605 9.3% 58.4 7.73sec 20161 0 15220 31866 59219 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.42 58.42 0.00 0.00 0.0000 0.0000 1177836
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.31% 15219.74 10383 28747 625192
crit 17.3 29.69% 31865.56 21389 59219 552644

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 1636 5.8% 58.4 7.73sec 12664 0 9559 20030 37012 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.42 58.42 0.00 0.00 0.0000 0.0000 739839
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.35% 9559.19 6489 17967 392868
crit 17.3 29.65% 20030.38 13368 37012 346970

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
slam 1567 5.6% 32.7 13.46sec 21688 14360 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.66 32.66 0.00 0.00 1.5102 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1567 5.6% 32.7 13.46sec 21688 0 16615 34265 67912 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.66 32.66 0.00 0.00 0.0000 0.0000 708350
Direct Results Count Pct Average Min Max Total Damage
hit 23.3 71.26% 16614.82 12171 32967 386703
crit 9.4 28.74% 34265.11 25206 67912 321647

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_2h_T11_372
bloodthirst rage 46.1% 1368.5 20
colossus_smash rage 7.5% 733.6 20
death_wish rage 0.5% 0.0 7
execute rage 8.1% 1124.8 28
heroic_strike rage 18.3% 1034.7 19
raging_blow rage 19.6% 1709.9 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.1 362.7 30.0 0.0%
berserker_rage rage 9.5 75.2 7.9 0.7%
melee_main_hand rage 146.2 3555.6 24.3 1.6%
melee_off_hand rage 145.7 1789.6 12.3 0.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 19.8 0.0 21.6sec 21.6sec 8% 9%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 9.5 0.0 44.6sec 44.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.2sec 123.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.1sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 33.5 6.2 13.3sec 11.2sec 27% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 15.2 30.3 28.1sec 9.1sec 52% 51%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 15.3 45.1sec 5.5sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 49.2 144.7 9.3sec 2.3sec 78% 76%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 338.9sec 338.9sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 105.8sec 105.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.2 0.0 41.0sec 41.0sec 10% 17%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 14.3 20.6 31.6sec 12.6sec 60% 61%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.5 46.1sec 32.8sec 29% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 57.4 382.7sec 7.7sec 99% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.9%

Procs

Count Interval
munched_deep_wounds 34.2 13.5sec
rolled_deep_wounds 31.0 14.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.42%
σ of the average dps 9.4045
2 * σ / μ 0.0669%
95% Confidence Intervall ( μ ± 2σ ) ( 28105.66 - 28143.28 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28096.26 - 28152.68 )
Sample Data
σ 940.4548
Minimum 24311.78
Maximum 31703.15
Spread ( max - min ) 7391.37
Range ( max - min ) / 2 3695.69
Range% 13.14
10th Percentile 26931.22
90th Percentile 29343.03
( 90th Percentile - 10th Percentile ) 2411.82
Approx. Iterations needed for
1% dps error 44
0.1% dps error 4472
0.1 scale factor error with delta=300 7861
0.05 scale factor error with delta=300 31447
0.01 scale factor error with delta=300 786182
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
G raging_blow
H slam,if=buff.bloodsurge.react
I execute,if=rage>=50
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEGAEHEGEHAEGEAECEGEHEFAGEHAJEAGEACEAGEEEAGEAEGECAEGAEHAEGAEJAEFGEAECAEGEHEHAEEGEECAEGHEHEFGEJAEGAECEAEEEEFGE7EACEAGEJEAGEHEGEHECAEGEHEFGEHEGEHECJAEGEEAGEHEFGEHCEAGEEGEHEAGEJAECAEHEG6HEFAEGAEAEGCAEHAEGAEJAEGAEEGECEHEAGEHEG7HEJAECAEGEHEGEEAGEECAEFGHJEGEHEGEECAEGEHEGEEFGEJCAEGEGEEHAEFGCAEAEGEHAEGJEAEGCEGEAHEGEEFAGEACEGEJEGE7EGBDDCDDEEABEGEHBCDJDDDEAHEGB6EIECEGBEHGEAHBDDDDCJEGBEAHEFGBEAHEAGBCEEBEJIEFGE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6519 5223 4782
Agility 729 145 20
Stamina 8265 6613 6440
Intellect 55 53 20
Spirit 82 82 20
Health 158665 135607 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 7.87% 7.87% 806
Spell Crit 21.01% 16.01% 2691
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14783 10845 190
Melee Hit 9.71% 9.71% 806
Melee Crit 24.00% 16.61% 2691
Melee Haste 5.13% 5.13% 657
Expertise 26.01 26.01 781
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 10.51% 10.51% 1526

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 1
Single-Minded Fury 0
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_2h_T11_372
origin="http://chardev.org/?profile=36611"
level=85
race=worgen
role=attack
use_pre_potion=1
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
glyphs=death_wish/cleaving/heroic_throw/bloody_healing/battle/berserker_rage/bloodthirst/raging_blow/slam
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4782
# gear_agility=20
# gear_stamina=6440
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=806
# gear_crit_rating=2691
# gear_haste_rating=657
# gear_mastery_rating=1526
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket1=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Auras/Buffs

Constant Buff
abominations_might
arcane_tactics
battle_shout
communion
demonic_Pact
devotion_aura
elemental_oath
fel_intelligence
ferocious_inspiration
flametongue_totem
honor_among_thieves
horn_of_winter
hunting_party
improved_icy_talons
leader_of_the_pack
mana_spring_totem
mind_quickening
moonkin
qiraji_fortitude
rampage
roar_of_courage
strength_of_earth
trueshot
unleashed_rage
windfury_totem
wrath_of_air

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
0.0 0.00 / 0.00% 0.0 870703.6 0.0 health 100.02% 0.0

Charts

http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8777776666555544443333332222221111110000000zzzzzzzyyyyyyyyxxxxxxxwwwwwwwwvvvvvvvvuuuuuuuuuttttttttsssssssssrrrrrrrrqqqqqqqqpppppppoooooooonnnnnnnnmmmmmmmlllllllllkkkkkkkkjjjjjjjjjiiiiiiiiihhhhhhhggggggggffffffffeeeeeeeeddddddddccccccccbbbbbbbbaaaaaaaaZZZZZZZYYYYYYYYXXXXXXXXWWWWWWWWWVVVVVVVVUUUUUUUUTTTTTTTTSSSSSSSSSRRRRRRRQQQQQQQQPPPPPPPPOOOOOOOONNNNNNNNMMMMMMMMMMMMLLLLLLLLLLLLLLKKKKKKKKKKKKKKJJJJJJJJJJJJJJJIIIIIIIIIIIIIIIIHHHHHHHHHHHHHHGGGGGGGGGGG&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=393046251&chtt=Fluffy_Pillow+Health+Timeline&chts=dddddd,18&chco=336600 http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=0|max=0&chxp=1,1,-nan,100&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18

Abilities

Resources

Resource Usage Type Res% DPR RPE
Fluffy_Pillow
Resource Gains Type Count health Average Overflow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs
bleeding

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_bleed

Database details

  • id:
  • cooldown name:buff_blood_frenzy_bleed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_physical

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
brittle_bones

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
corrosive_spit

Database details

  • id:95466
  • cooldown name:buff_corrosive_spit
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
critical_mass

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:$s1% additional chance to be critically hit by spells.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
curse_of_elements

Database details

  • id:
  • cooldown name:buff_curse_of_elements
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_roar

Database details

  • id:99
  • cooldown name:buff_demoralizing_roar
  • tooltip:Reduces physical damage caused by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_screech

Database details

  • id:24423
  • cooldown name:buff_demoralizing_screech
  • tooltip:Physical damage reduced by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
demoralizing_shout

Database details

  • id:
  • cooldown name:buff_demoralizing_shout
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
earth_and_moon

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
ebon_plague

Database details

  • id:
  • cooldown name:buff_ebon_plague
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
expose_armor

Database details

  • id:
  • cooldown name:buff_expose_armor
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
faerie_fire

Database details

  • id:91565
  • cooldown name:buff_faerie_fire
  • tooltip:Armor reduced by $s1%. Cannot stealth or turn invisible.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
hemorrhage

Database details

  • id:
  • cooldown name:buff_hemorrhage
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
hunters_mark

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
infected_wounds

Database details

  • id:
  • cooldown name:buff_infected_wounds
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_just

Database details

  • id:
  • cooldown name:buff_judgements_of_the_just
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_breath

Database details

  • id:24844
  • cooldown name:buff_lightning_breath
  • tooltip:Increases magic damage taken by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
mangle

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
master_poisoner

Database details

  • id:
  • cooldown name:buff_master_poisoner
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
poisoned

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ravage

Database details

  • id:50518
  • cooldown name:buff_ravage
  • tooltip:Increases physical damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
savage_combat

Database details

  • id:
  • cooldown name:buff_savage_combat
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
scarlet_fever

Database details

  • id:
  • cooldown name:buff_scarlet_fever
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_and_flame

Database details

  • id:17800
  • cooldown name:buff_shadow_and_flame
  • tooltip:Chance to be critically hit with spells increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sunder_armor

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
tailspin

Database details

  • id:90315
  • cooldown name:buff_tailspin
  • tooltip:Melee and ranged attack speed reduced by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tear_armor

Database details

  • id:95467
  • cooldown name:buff_tear_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
tendon_rip

Database details

  • id:50271
  • cooldown name:buff_tendon_rip
  • tooltip:All bleed effects cause $s1% additional damage.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
thunder_clap

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vindication

Database details

  • id:
  • cooldown name:buff_vindication
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 0.00%
σ of the average dps 0.0000
2 * σ / μ 0.0000%
95% Confidence Intervall ( μ ± 2σ ) ( 0.00 - 0.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 0.00% - 0.00% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 0.00 - 0.00 )
Sample Data
σ 0.0000
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range ( max - min ) / 2 0.00
Range% 0.00
10th Percentile 0.00
90th Percentile 0.00
( 90th Percentile - 10th Percentile ) 0.00
Approx. Iterations needed for
1% dps error 0
0.1% dps error 0
0.1 scale factor error with delta=300 0
0.05 scale factor error with delta=300 0
0.01 scale factor error with delta=300 0
DPS Timeline Chart

Action Priority List

# action,conditions
0 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 470487787 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 8.00% 8.00% 0

Gear

Encoded
head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty

Talents

Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Improved Cower 0
Bloodthirsty 0
Spiked Collar 0
Boar's Speed 0
Culling the Herd 0
Lionhearted 0
Swoop 0
Charge 0
Heart of the Phoenix 0
Spider's Bite 0
Great Resistance 0
Rabid 0
Lick Your Wounds 0
Call of the Wild 0
Shark Attack 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Charge 0
Great Stamina 0
Natural Armor 0
Spiked Collar 0
Boar's Speed 0
Blood of the Rhino 0
Pet Barding 0
Culling the Herd 0
Guard Dog 0
Lionhearted 0
Thunderstomp 0
Grace of the Mantis 0
Great Resistance 0
Last Stand 0
Taunt 0
Roar of Sacrifice 0
Intervene 0
Silverback 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Boar's Speed 0
Mobility 0
Mobility 0
Owl's Focus 0
Spiked Collar 0
Culling the Herd 0
Lionhearted 0
Carrion Feeder 0
Great Resistance 0
Cornered 0
Feeding Frenzy 0
Wolverine Bite 0
Roar of Recovery 0
Bullheaded 0
Grace of the Mantis 0
Wild Hunt 0
Roar of Sacrifice 0

Profile

#!./simc

enemy=Fluffy_Pillow
origin="unknown"
level=88
race=humanoid
role=tank
use_pre_potion=1
talents=http://www.wowhead.com/talent#enemy-000000000000000000000000000000000000000000000000000000000000000
actions=snapshot_stats
# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per second.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg

Convergence

Rate at which multipling iterations by convergence_scale reduces error

For default convergence_scale=2 it should itself approach 70.71% according to the central limit theorem

G%

Percentage of executes that resulted in glancing blows.

G%

Percentage of executes that resulted in blocking blows.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Max

Maximum crit damage over all iterations.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps_max - dps_min ) / ( 2 * dps_avg )

RPS In

Average resource points generated per second.

RPS Out

Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.